Tap / click on image to see more RealViewsTM
CA$5.05
per sticker
 

RAVENCLAW™ Crosshatched Emblem

Officially Licensed
Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 7.62 cm x 7.62 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

RAVENCLAW™ Crosshatched Emblem

RAVENCLAW™ Crosshatched Emblem

HARRY POTTER™ | The Ravenclaw House Lion stylized with crosshatching, geometric shapes, and filigree.

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
921 total 5-star reviews74 total 4-star reviews28 total 3-star reviews32 total 2-star reviews94 total 1-star reviews
1,149 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mary B.January 14, 2022Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I put this sticker on my water bottle and it's holding up great. I've put it through the dishwasher twice and it still looks new. Bright colors, clean lines, sticks well, great quality!
from zazzle.com (US)
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Megan O.January 22, 2024Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristin R.January 2, 2020Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great

Tags

Custom-Cut Vinyl Stickers
harry potterhogwartsschoolwitchcraftwizardrymagickidsravenclaweaglecrosshatch
All Products
harry potterhogwartsschoolwitchcraftwizardrymagickidsravenclaweaglecrosshatch

Other Info

Product ID: 256747414386222694
Designed on 2020-10-27, 11:05 AM
Rating: G 
TM & © WBEI. Harry Potter Publishing Rights © JKR. (s23)