Sell on Zazzle
Tap / click on image to see more RealViewsTM
CA$5.05
per sticker
 

RAVENCLAW™ Crosshatched Emblem

4.5 out of 5 stars rating
1128 Total Reviews |
by
Officially Licensed
Qty:
Sticker Sheet Size
Media

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by
Custom-Cut Vinyl StickerCreate your own from scratch

Sticker Sheet Size: Extra-Small 7.62 cm x 7.62 cm Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 7.6 cm L x 3.12.7 cm W
  • Design Area: 7.6 cm L x 7.6 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

RAVENCLAW™ Crosshatched Emblem

RAVENCLAW™ Crosshatched Emblem

HARRY POTTER™ | The Ravenclaw House Lion stylized with crosshatching, geometric shapes, and filigree.
HARRY POTTER™
Artwork designed by
Officially Licensed
View their Store
Contact

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
915 total 5-star reviews72 total 4-star reviews28 total 3-star reviews29 total 2-star reviews84 total 1-star reviews
1,128 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By Mary B.January 14, 2022 • Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I put this sticker on my water bottle and it's holding up great. I've put it through the dishwasher twice and it still looks new. Bright colors, clean lines, sticks well, great quality!
from zazzle.com (US)
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By Katie L.October 18, 2022 • Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Zazzle Reviewer Program
I love the clear background so that all you see is the writing, looks very elegant. Little on the pricey side, but worth it. They stick great to my plastic containers, hopefully it withstands in the shower. Printing was flawless
5.0 out of 5 stars rating
5 out of 5 stars rating
By Megan O.January 22, 2024 • Verified Purchase
Large 20.32 cm x 20.32 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.

Tags

Custom-Cut Vinyl Stickers
harry potterhogwartsschoolwitchcraftwizardrymagickidsravenclaweaglecrosshatch
All Products
harry potterhogwartsschoolwitchcraftwizardrymagickidsravenclaweaglecrosshatch

Other Info

Product ID: 256747414386222694
Designed on 2020-10-27, 11:05 AM
Rating: G 
TM & © WBEI. Harry Potter Publishing Rights © JKR. (s23)