Tap / click on image to see more RealViewsTM
CA$52.35
per round throw pillow
 

Purple Shroom Round Pillow

Qty:

About Round Pillows

Sold by

Size: Round Throw Pillow 41 x 41 cm

Zazzle cushions now come in even more sizes and shapes! Make a statement without having to say a word when you accent your home with fully customisable cushions from Zazzle. Made from high-quality fabric, these soft cushions look great with your personalised designs, quotes monograms, and photos. The perfect complement to your living room, bedroom, and more!

  • Dimensions: 40.6 cm diameter (flat), 35.5 cm (stuffed)
  • Hidden zipper enclosure; synthetic-filled insert included
  • Made in the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 40.6 cm (16" x 16"). For best results please add 1.9 cm (3/4") bleed..

Fabric: Brushed Polyester

  • 100% brushed polyester is wrinkle free
  • Vibrant colours help designs really pop
  • Heavy cotton-blend-type texture makes fabric soft to the touch
  • High tensile strength fabric make for long lasting quality
  • Inserts are hypoallergenic and filled with a faux down polyester fibre
  • Machine washable, able to retain colour and resist shrinkage

About This Design

Purple Shroom Round Pillow

Purple Shroom Round Pillow

Add a touch of whimsical charm to your space with this round pillow featuring a vibrant purple mushroom motif. The soft, plush fabric offers cozy comfort, while the detailed mushroom design brings a playful and mystical vibe to any room. Perfect for adding a pop of colour to your couch, bed or favourite chair, this pillow is both stylish and functional, making it an ideal accent piece for nature and mushroom lovers.

Customer Reviews

4.6 out of 5 stars rating305 Total Reviews
239 total 5-star reviews39 total 4-star reviews14 total 3-star reviews4 total 2-star reviews9 total 1-star reviews
305 Reviews
Reviews for similar products
5 out of 5 stars rating
By R.February 28, 2022Verified Purchase
Brushed Polyester Round Throw Pillow 41 x 41 cm
Zazzle Reviewer Program
I bought this for my friend's birthday and she loved it. the print was perfect and arrived exactly how I wanted it.
5 out of 5 stars rating
By Robin M.April 10, 2023Verified Purchase
Brushed Polyester Round Throw Pillow 41 x 41 cm
Zazzle Reviewer Program
Exactly as promised and delivered quickly. Exactly what we asked for
4 out of 5 stars rating
By Christina P.December 15, 2020Verified Purchase
Brushed Polyester Round Throw Pillow 41 x 41 cm
Zazzle Reviewer Program
I am pleased with this product, although there are a few minor points. It seems the fabric weaves are a bit large, which means the details of any text based photo will become slightly blurry. I'm not sure if this is printer related, but rather trying to print on the particular type of material. The zipper and seams were well made, and the prints were equal on both sides. The pillow circumference is not perfectly smooth, there are ridges (as seen in the stock photos). I did find my pillow didn't have the most even distribution of polyester, such that the top half was very round and lovely, but the bottom end had more kinds and could do with more stuffing (which I think I can easily do!). The colours came out as expected and quiet lovely. However the main focal point of the pillow (a vector black text image) was printed slightly blurry. The background colours and textures were true to the design. Reminder: Always expect less vibrancy than what is seen on the screen.

Tags

Round Pillows
mushroommagicwhimsicalhippyfantasynaturevibrantcozy
All Products
mushroommagicwhimsicalhippyfantasynaturevibrantcozy

Other Info

Product ID: 256060832306113880
Designed on 2024-08-28, 10:16 AM
Rating: G