Tap / click on image to see more RealViewsTM
CA$69.15
per set of 50 napkins
 

Purple Pink Blue Butterfly Bridal Shower Napkin

Qty:
White

Other designs from this category

Shop this collection

Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Paper Napkins

Sold by

Style: Standard Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalized paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 12 cm l x 12 w cm (folded), 3 ply
  • Printed in full colour on your choice of white or ecru coloured napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Purple Pink Blue Butterfly Bridal Shower Napkin

Purple Pink Blue Butterfly Bridal Shower Napkin

Personalize this exquisite Butterfly Bridal Shower Paper Napkin, a charming addition to your celebration. Embrace the whimsical beauty of fluttering pink, blue, and purple butterflies delicately adorned against a crisp white background. Each napkin is adorned with soft tones, featuring delicate white flowers intertwined with the elegant butterfly motif, creating a picturesque scene that exudes both femininity and grace. Featuring a boho floral design, these paper napkins effortlessly elevate any bridal shower decor, adding a touch of enchantment and sophistication to your event. Whether you're hosting a bridal shower party, picnic or a lavish affair, these pretty napkins are sure to impress your guests with their timeless elegance.

Customer Reviews

4.7 out of 5 stars rating1.3K Total Reviews
1120 total 5-star reviews94 total 4-star reviews35 total 3-star reviews25 total 2-star reviews48 total 1-star reviews
1,322 Reviews
Reviews for similar products
5 out of 5 stars rating
By C.March 26, 2024Verified Purchase
Paper Napkins, Standard Cocktail
The napkins were amazing. They were a huge hit at our event. I love that you can customize them and they are great quality. The printing was great quality and exactly what I expected.
4 out of 5 stars rating
By Gabrielle C.May 29, 2021Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
my first package was “lost” in the mail and didn’t show up and the team at Zazzle was quick to fix it! They were kind and understanding and sent out a new package by their top mailing system at no charge to me. I am very thankful Zazzle! The product turned out well, I’m pleased with my order
5 out of 5 stars rating
By Monica W.July 9, 2021Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
The napkins came in exactly what I ordered. Printed to what I had ordered

Tags

Paper Napkins
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine
All Products
butterfly bridal showerpurplepinkblueboho floralflowersbridal showercalligraphywhimsicalfeminine

Other Info

Product ID: 256280182806499442
Designed on 2024-09-10, 3:06 AM
Rating: G