Tap / click on image to see more RealViewsTM
CA$61.75
per clipboard
 

Pretty Pink Floral Script Monogram Initial Name Clipboard

Qty:

Other designs from this category

About Clipboard

Sold by

Style: Clipboard

Stay organised, and stunningly stylish, with custom clipboards from Zazzle! Use your favourite design, images or text to transform this basic school supply into a stunning accessory, that will keep you on track, always!

  • Dimensions: 31.75 cm L x 22.86 cm W; thickness: 0.31 cm
  • Designed for letter and A4 sized paper
  • Holds up to 1.27 cm of paper securely
  • Made of ultra-durable acrylic
  • Printed on both sides
  • /!\WARNING: CHOKING HAZARD - small parts.
  • Not for children under 3 yrs.

About This Design

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty Pink Floral Script Monogram Initial Name Clipboard

Pretty, modern and elegant, this trendy clipboard design features a hand painted watercolor floral motif in the corner, with your name and monogram initial in pink and soft grey hand lettered script typography, and is bordered in matching pink. Copyright Anastasia Surridge for Personalized Home Decor, all rights reserved.

Customer Reviews

4.8 out of 5 stars rating398 Total Reviews
357 total 5-star reviews28 total 4-star reviews5 total 3-star reviews6 total 2-star reviews2 total 1-star reviews
398 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jayme I.October 10, 2022Verified Purchase
Clipboard
Zazzle Reviewer Program
Turned out as expected. Love using this daily in my practice and what's better is that my colleagues don't walk off with my clipboard anymore. Looks as expected. Turned out well.
5 out of 5 stars rating
By Anne-Marie K.February 6, 2021Verified Purchase
Clipboard
Zazzle Reviewer Program
It is exactly as shown on the website. Very good quality. Thank you. Perfectly. Pictures were very clear and colours very natural.
4 out of 5 stars rating
By F.November 19, 2018Verified Purchase
Clipboard
Zazzle Reviewer Program
Although the product was expensive, we customized it entirely and it looked exactly as planned/advertised. The products looks like it is made of pretty good material. The product arrived within 4 business days of ordering and allowed a feature to track the package. If you are wondering, it has a plastic front that looks like a front of a whiteboard marker but does not function as a whiteboard because whiteboard marker does not erase. The colours were as expected and the images printed well.

Tags

Clipboard
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram
All Products
pinkgirlyprettychicscriptelegantinitialnamefloralmonogram

Other Info

Product ID: 256132108931783769
Designed on 2021-10-20, 5:13 PM
Rating: G