Tap / click on image to see more RealViewsTM
CA$13.05
per sticker
 

Playful friends drawing on

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Large 20.32 cm x 20.32 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 20.32 cm L x 21.59 cm H
  • Design Area: 20.32 cm L x 20.32 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof, and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Playful friends drawing on

Playful friends drawing on

Playful friends drawing design.

Customer Reviews

4.8 out of 5 stars rating12 Total Reviews
11 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
12 Reviews
Reviews for similar products
5 out of 5 stars rating
By Jaimin p.October 11, 2022Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
Great sticker to decorate guitar, car or electronics. High quality with proper color
5 out of 5 stars rating
By Marie S.June 1, 2021Verified Purchase
Medium 15.24 cm x15.24 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Creator Review
Looks great! A variety of bright color designs for fun and whimsy. Gift for a book loving sister who gave me (the artist) lots of feedback on the design. These are Custom-Cut Vinyl Sticker and low tack ~ very cool! Very pleased. It comes with a choice of each sticker with a white outline. In hindsight the clear option would have been preferred but depends on it's placement too. Fun!
from zazzle.com (US)
5 out of 5 stars rating
By Alaenya H.January 13, 2022Verified Purchase
Extra-Small 7.62 cm x 7.62 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
My niece was born in AZ and she wanted a sticker for her water bottle from where she was born. She loved this design. The image quality was beautiful!
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
boygirlfriendsdrawingwhitepatternplayhappysmile
All Products
boygirlfriendsdrawingwhitepatternplayhappysmile

Other Info

Product ID: 256993414820906350
Designed on 2022-06-01, 11:28 AM
Rating: G