Tap / click on image to see more RealViewsTM
CA$78.45
per print set
 

one line woman and leaf wall art set

by
Qty:
18"x24"
Inset Faux White Mat

Other designs from this category

About Print Sets

Sold by

Set Size: Set of 2

translate into british english This custom Print Set is your personal art gallery! Display your favorite photos of your loved ones, special moments, or personal designs and artwork. Whether you're looking to create a gallery wall or just add a touch of elegance to a single room, our Print Sets are the perfect solution. Show off your unique style with this personalised addition to your home decor.
  • Choice of set sizes: 2, 3, or 4 prints
  • 10 standard sizes to choose from
  • Printed on quality paper for long-lasting memories
  • 3 wooden frame options available, with the option of borders and matting
  • With frames selected they’re ready to hang for easy and convenient display
  • Borders and matting options may vary based on selected frame and print size
  • Frames include Non-Glare Acrylic Glazing

Paper Type: Value Poster Paper (matte)

Your walls are a reflection of your personality, so let them speak with your favourite quotes, art, or designs printed on our custom Giclee posters! Choose from 2 unique, high-quality paper types to meet your creative or business needs. All are excellent options that feature a smooth surface with vibrant full-colour printing. Using pigment-based inks (rather than dye-based inks), your photos and artwork will be printed at the highest resolution, preserving all their original detail and full-colour spectrum. Browse through standard or custom size posters and framing options to create art that’s a perfect representation of you.

  • Gallery-quality Giclee prints
  • Ideal for vibrant artwork and photo reproduction
  • Matte finish with an acid-free smooth surface
  • Pigment-based inks for full-colour spectrum high-resolution printing
  • 45 lb., 7.5-point thick poster paper

About This Design

one line woman and leaf wall art set

one line woman and leaf wall art set

Transform your space with this elegant set of two abstract wall art prints, featuring minimalist one-line drawings. Each print in the set presents a unique blend of fluid lines, showcasing a female figure intertwined with a delicate leaf motif. These artworks embody the essence of simplicity and grace, making them perfect for those who appreciate modern and sophisticated decor. Printed on premium-quality paper, these versatile pieces are ideal for adding a stylish and artistic touch to any room, whether it’s a living room, bedroom, or office. Enhance your decor with this timeless set that brings both tranquillity and beauty to your walls.

Customer Reviews

There are no reviews for this product yet.Have you purchased this product?

Tags

Print Sets
bohoabstractminimalfemaletrendysketchwomanone line art drawingwall art sethome
All Products
bohoabstractminimalfemaletrendysketchwomanone line art drawingwall art sethome

Other Info

Product ID: 256235350041698114
Designed on 2024-08-30, 6:02 AM
Rating: G