Tap / click on image to see more RealViewsTM
No neon ink will be used when printing. Neon colors may appear darker than what you see on your screen.
CA$18.35
per sticker
 

Neon Pheasant Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 15.24 cm x 15.24 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 15.2 cm L x 16.5 cm cm W
  • Design Area: 15.2 cm L x 15.2 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

No neon ink will be used when printing. Neon colors may appear darker than what you see on your screen.
Neon Pheasant Sticker

Neon Pheasant Sticker

This retro Neon Pheasant in mid-flight, designed to look like an old roadside advertisement, is the perfect way to personalize any product or express your love for the outdoors, hunting, or wildlife. Part of a growing series featuring wildlife and game fish, collect them to build your own personal collection of expression!

Customer Reviews

4.4 out of 5 stars rating46 Total Reviews
36 total 5-star reviews3 total 4-star reviews2 total 3-star reviews1 total 2-star reviews4 total 1-star reviews
46 Reviews
Reviews for similar products
3.0 out of 5 stars rating
3 out of 5 stars rating
By Peter H.September 5, 2023Verified Purchase
10.16 cm x 10.16 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The product was good but not to my liking. The color was fine the printing was too small!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jessica L.May 23, 2024Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Glossy clear
I looked at a few templates for creating my own and decided on this one as it was the clearest indication that 1. indeed the background would be removed (white) and 2. was water proof for car window or in my case motorcycle helmet. Turned out perfect, and they were easy to peel off. Ignore the little bumps in the photo as I had not smoothed it down when taking the pic yet
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kathryn T.July 19, 2024Verified Purchase
35.56 cm x 35.56 cm Custom-Cut Vinyl Stickers, Glossy clear
New Mexico, transplant, military brat, dandelion, and New Mexico. Zia symbol. Land of enchantment. Love this window sticker helps me pick out my car out of a bunch of other white cars! The quality of the stickers wonderful and came out just the way I wanted! Love it! Satisfied customer. .
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
neonretrogifthuntingpheasantstickerwildlifeanimal
All Products
neonretrogifthuntingpheasantstickerwildlifeanimal

Other Info

Product ID: 256124873086311867
Designed on 2025-08-05, 5:43 PM
Rating: G