Tap / click on image to see more RealViewsTM
CA$45.55
per mug
 

Mug-Buck Coffee Mug

Qty:
  1. Style

  2. Size

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalize your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Mug-Buck Coffee Mug

Mug-Buck Coffee Mug

Vintage image courtesy of Wikimedia Commons, public domain images...create on your choice of any mug. Composed in Photoshop

Customer Reviews

4.8 out of 5 stars rating22.8K Total Reviews
20111 total 5-star reviews1920 total 4-star reviews351 total 3-star reviews165 total 2-star reviews295 total 1-star reviews
22,842 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jesmina B.January 7, 2024Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
My order was on time, and looked exactly how it appeared on the order site. Printing is gorgeous and so far lasting really well.
5.0 out of 5 stars rating
5 out of 5 stars rating
By DerekAugust 16, 2022Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
Replacement mug arrived today and in record time!! (The original one was damaged in shipping) The mug is in perfect condition. Thanks to Zazzle for excellent customer service. Derek. The printing is beautiful. A nicely inspired design.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristie N.December 15, 2020Verified Purchase
Classic Mug, 444 ml
Zazzle Reviewer Program
I bought these mugs to give to my clients and people connected to my business and they have had great success. Very happy with the outcome, the service, and the product. Printing turned out great, colours with vibrant and product looks clear and professional. Happy with the results.

Tags

Mugs
deerbuckswildlifeanimalsgiftsvintagemugs
All Products
deerbuckswildlifeanimalsgiftsvintagemugs

Other Info

Product ID: 168029996757539293
Designed on 2012-09-27, 11:41 AM
Rating: G