Tap / click on image to see more RealViewsTM
CA$71.90
per pillow
 

Mr & Mrs photo Throw Pillow

Qty:
40 cm Throw Pillow
+CA$13.45
+CA$36.10

Other designs from this category

About Pillows

Sold by

Size: 40 cm Throw Pillow

Accent your home with custom pillows from Zazzle and make yourself the envy of the neighborhood. Made from high-quality Simplex knit fabric, these 100% polyester pillows are soft and wrinkle-free. The heavyweight stretch material provides beautiful color definition for your design while also being the perfect complement to your couch!

  • Dimensions: 16" x 16" (40.6 cm x 40.6 cm)(square)
  • Simplex knit fabric; 100% polyester; wrinkle-free
  • Hidden zipper enclosure; synthetic-filled insert included
  • Machine washable
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 16" x 16"(40.6 cm x 40.6 cm). For best results please add 0.59"(1.5 cm) bleed.

About This Design

 Mr & Mrs photo Throw Pillow

Mr & Mrs photo Throw Pillow

Celebrate love in elegant style with this timeless "Mr. & Mrs." script design. Featuring modern calligraphy with a romantic touch. Perfect for yourself or as a gift. Whether you're personalizing for yourself or as a gift, this classic motif adds a sophisticated and heartfelt touch to any occasion.

Customer Reviews

4.7 out of 5 stars rating231 Total Reviews
189 total 5-star reviews32 total 4-star reviews5 total 3-star reviews3 total 2-star reviews2 total 1-star reviews
231 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Prasanthy L.March 6, 2022Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Very neat work and attractive throw pillow. The image was bright and the bride loved it so much. it was a great gift for bridal shower. printing was very clear and turn out very well
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gina R.November 26, 2021Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Great quality and original. Really nice! The writing was clear and great quality
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousMarch 19, 2018Verified Purchase
Throw Pillow, 40 cm Throw Pillow
Zazzle Reviewer Program
Bought this for my wife for our anniversary. She loves it. Printing is very clear and looks wonderful

Tags

Pillows
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary
All Products
mr and mrsgiftkeepsakenewlywedsscriptjust marriedelegantcouples giftweddinganniversary

Other Info

Product ID: 256765352674582625
Designed on 2025-08-07, 5:15 AM
Rating: G