Tap / click on image to see more RealViewsTM
The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
CA$42.70
per keychain
 

Monogram Blue & Silver Filigree Motif Key Chain

Qty:
Premium Square
-CA$15.55
-CA$19.85
-CA$15.55
+CA$1.10
Large (2.00")

Other designs from this category

About Keychains

Sold by

Style: Premium Square Keychain

You will never lose your keys or forget your favourite memory with this custom square keyring from Zazzle. The waterproof, UV coating will keep your images looking like new for years to come and keep your memories fresh as if they just happened yesterday!

  • Dimensions:
    • Measurements: 5.08 cm l x 5.08 cm w
    • Depth: 0.48 cm
    • Weight: 20 g
  • Full-colour, full-bleed printing
  • Silver-coloured metal charm & ring
  • UV resistant and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 4.65 cm x 4.65 cm. For best results please add 1.6 mm bleed

About This Design

The lace detailed are simulated in the artwork. No actual lace will be used in the making of this product.
Monogram Blue & Silver Filigree Motif Key Chain

Monogram Blue & Silver Filigree Motif Key Chain

*Customize with your text.

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4280 total 5-star reviews790 total 4-star reviews217 total 3-star reviews118 total 2-star reviews102 total 1-star reviews
5,507 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.October 14, 2023Verified Purchase
Metal Square Keychain, 5.71 cm x 5.71 cm
Zazzle Reviewer Program
It's perfect quality and is beautiful. Clear and nice, highly recommended
5 out of 5 stars rating
By Christine L.January 14, 2023Verified Purchase
Premium Square Keychain, Large (5.08 cm)
Zazzle Reviewer Program
If as perfect, it’s used as the key chain for the kart hauler perfect. Everything was great he loves it!
5 out of 5 stars rating
By LAURA R.November 20, 2020Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
It was extremely difficult to predict what this was going to look like. I couldn't tell if it would be a thin film of plastic sheet over the custom message. In fact, it is a resin coating and it is gorgeous. The font I chose is a bit too small but it is wonderful and I love it. The printing is smaller than I would have liked, but I will keep it.

Tags

Keychains
bluesilvermonogramclassychicelegantprettyfiligreelacesquare
All Products
bluesilvermonogramclassychicelegantprettyfiligreelacesquare

Other Info

Product ID: 146454319706538101
Designed on 2017-06-17, 7:50 PM
Rating: G