Tap / click on image to see more RealViewsTM
CA$11.20
per sticker
 

Matilde Name Kiwi Design Decal Sticker

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 10.16 cm x 10.16 cm

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 10.2 cm L x 4.12.7 cm W
  • Design Area: 10.2 cm L x 10.2 cm W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.1212.7 cm border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Matilde Name Kiwi Design Decal Sticker

Matilde Name Kiwi Design Decal Sticker

A very beautiful, stylish, personalized sticker in kiwi design for Matilde.

Customer Reviews

4.5 out of 5 stars rating1.2K Total Reviews
921 total 5-star reviews74 total 4-star reviews28 total 3-star reviews32 total 2-star reviews95 total 1-star reviews
1,150 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Megan O.January 22, 2024Verified Purchase
20.32 cm x 20.32 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These stickers are absolutely lovely. They're quite durable (I've got one on a water bottle) and the colours really pop, which is why I went with the Warblers set. I love that these are the perfect blend of cuteness and realism. Colours are sharp, material is thick and durable.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristin R.January 2, 2020Verified Purchase
7.62 cm x 7.62 cm Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
This sticker was exactly as it was in the picture! This was a great way for my husband and I to support and celebrate our favorite indie show. The printing quality was great
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ralf K.February 27, 2023Verified Purchase
Zazzle Reviewer Program
They worked perfect for our signs! Perfect! excellent quality.

Tags

Custom-Cut Vinyl Stickers
firstnamenamebirthdayhappystickerdecalgiftkiwimatilda
All Products
firstnamenamebirthdayhappystickerdecalgiftkiwimatilda

Other Info

Product ID: 256057066983912989
Designed on 2021-10-04, 8:51 PM
Rating: G