Tap / click on image to see more RealViewsTM
Sale Price CA$3.78.  
Original Price CA$5.03 per card
You save 25%

Loving Words Valentine's Day Greeting Card

Qty:
Choose Your Format
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
+CA$0.95
+CA$0.95
-CA$0.25

Other designs from this category

About Folded Holiday Cards

Sold by

Size: 12,7 × 17,8 cm

Wishing everyone a season of gladness, a season of cheer and to top it all off, a wonderful year. Holiday cards designed to brighten up the entire year.

  • Dimensions: 12.7 cm x 17.8 cm (portrait); 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper Type: Signature Matte

Our Signature Matte paper is a customer favourite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle

About This Design

Loving Words Valentine's Day Greeting Card

Loving Words Valentine's Day Greeting Card

a unique approach to valentine's day cards...© 2004-2014 MarloDee Designs :: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing.

Customer Reviews

4.9 out of 5 stars rating7K Total Reviews
6464 total 5-star reviews338 total 4-star reviews67 total 3-star reviews33 total 2-star reviews59 total 1-star reviews
6,961 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Yohannes A.February 7, 2022Verified Purchase
Folded Holiday Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte
Zazzle Reviewer Program
I never write reviews but I’m so happy with the photo card I ordered and came perfectly printed. Delivery was on time as well. Keep up the good work you all. Excellent printing on card
5.0 out of 5 stars rating
5 out of 5 stars rating
By RomanApril 16, 2021Verified Purchase
Folded Holiday Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte
Zazzle Reviewer Program
My friend who owns a Black Cat enjoys the cards I give her that feature a Black Cat - and this one was no exception. The printing on the card turned out exactly as I expected, with the right font and printed clear as day.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Christine E.February 4, 2021Verified Purchase
Folded Holiday Card, Size: 12,7 × 17,8 cm, Paper: Signature Matte
Zazzle Reviewer Program
I love funny cards, especially on valentines, and I love to give my goofball boyfriend something to laugh about on valentines. This card would also work well on our anniversary or even his birthday. the printing was perfect, the card stock was high quality, and the size is just too good.

Tags

Folded Holiday Cards
valentinesdaylovesweetestweddingpinkchicstylishunique
All Products
valentinesdaylovesweetestweddingpinkchicstylishunique

Other Info

Product ID: 137642364302511547
Designed on 2014-01-19, 3:27 PM
Rating: G