Tap / click on image to see more RealViewsTM
CA$78.65
per wallpaper
 

Lily the Goat Peel & Stick Wallpaper

Qty:

About Wallpapers

Sold by

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish embossed with a canvas texture and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.

About This Design

Lily the Goat Peel & Stick Wallpaper

Lily the Goat Peel & Stick Wallpaper

Features my artwork.

Customer Reviews

4.1 out of 5 stars rating9 Total Reviews
6 total 5-star reviews0 total 4-star reviews2 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
9 Reviews
Reviews for similar products
5 out of 5 stars rating
By Awake A.April 12, 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
This is my second terrific, custom-designed Zazzle purchase. My custom-designed wallpaper is fabulous!! It arrived super well-packaged, and on time. It is really beautiful and of very high quality. I think this designer is extremely talented. She certainly knows how to follow instructions for a perfect custom design! You would do well to buy anything from Zazzle and, in particular, this designer. Excellent experience!!
from zazzle.com (US)
5 out of 5 stars rating
By Suzanne R.September 18, 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
from zazzle.com (US)
5 out of 5 stars rating
By Charles K.August 15, 2025Verified Purchase
Custom Wallpaper 0.61m x 1.22m, Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
from zazzle.com (US)

Tags

Wallpapers
lilylillygoatfarmanimalpinkpeelstickwallpaper
All Products
lilylillygoatfarmanimalpinkpeelstickwallpaper

Other Info

Product ID: 256471853455114670
Designed on 2024-08-13, 9:06 PM
Rating: G