Tap / click on image to see more RealViewsTM
CA$22.30
per sticker
 

Let's go Sticker Car

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: Extra-Large 35.56 cm x 35.56 cm Sheet

Contour kiss-cut vinyl stickers have never been this custom before! Now you can design your own personalized stickers and we’ll use our patented laser kiss-cut technology perfectly around them for you, die-cut style! You can add a single design to create one perfect sticker, or add multiple different designs to a sheet and create a sheet of stickers, each beautifully printed and individually kiss-cut. Zazzle’s custom kiss-cut stickers allow you to create and make your unique style really stick!

  • Sheet Dimensions: 35.56 cm L x 36.83 cm H
  • Design Area: 35.56 cm L x 35.56 cm H
  • Stickers are cut to the exact shape of your image on a vinyl sheet
  • Removable, low-tack adhesive leaves no sticky residue
  • Choice between matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks that are fade-proof, water-proof and scratch-resistant
  • Available in 6 sizes
  • 0.317 cm border will be added around each sticker to protect your design and also help it stand out against any background
⚠️ WARNING! Choking hazard — Small parts; Not for children under 3 years.

About This Design

Let's go Sticker Car

Let's go Sticker Car

Ignite your adventures with our vibrant "Let’s Go" sticker! Designed to inspire spontaneity and a love for the open road, this eye-catching sticker features bold, dynamic typography that captures the thrill of exploration. Stick it on your bumper, window, or wherever you want to spread the spirit of adventure. Let the world know you’re ready to hit the road and embrace every journey that comes your way!

Customer Reviews

4.4 out of 5 stars rating44 Total Reviews
35 total 5-star reviews2 total 4-star reviews2 total 3-star reviews1 total 2-star reviews4 total 1-star reviews
44 Reviews
Reviews for similar products
3 out of 5 stars rating
By Peter H.September 5, 2023Verified Purchase
Small 10.16 cm x10.16 cm Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
The product was good but not to my liking. The color was fine the printing was too small!
5 out of 5 stars rating
By Jessica L.May 23, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
I looked at a few templates for creating my own and decided on this one as it was the clearest indication that 1. indeed the background would be removed (white) and 2. was water proof for car window or in my case motorcycle helmet. Turned out perfect, and they were easy to peel off. Ignore the little bumps in the photo as I had not smoothed it down when taking the pic yet
from zazzle.com (US)
5 out of 5 stars rating
By Kathryn T.July 19, 2024Verified Purchase
Extra-Large 35.56 cm x 35.56 cm Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
New Mexico, transplant, military brat, dandelion, and New Mexico. Zia symbol. Land of enchantment. Love this window sticker helps me pick out my car out of a bunch of other white cars! The quality of the stickers wonderful and came out just the way I wanted! Love it! Satisfied customer. .
from zazzle.com (US)

Tags

Custom-Cut Vinyl Stickers
letsgostickeradventurestickertravelstickerroadtripstickerbumperstickervinylcarstickercaraccessoriestravelessentialsmotivationalstickercustomsticker
All Products
letsgostickeradventurestickertravelstickerroadtripstickerbumperstickervinylcarstickercaraccessoriestravelessentialsmotivationalstickercustomsticker

Other Info

Product ID: 256880978172582416
Designed on 2024-10-09, 1:12 AM
Rating: G