Tap / click on image to see more RealViewsTM
CA$8.95
per keychain
 

Kitty Bride to Be Key Chain

Qty:
Aluminum Circle
+CA$0.80
+CA$0.80
+CA$19.45
+CA$19.45

Other designs from this category

About Keychains

About This Design

Kitty Bride to Be Key Chain

Kitty Bride to Be Key Chain

Adorable Kitty Bride to Be Key Chain with painting motif by Lisa Lorenz

Customer Reviews

4.7 out of 5 stars rating152 Total Reviews
116 total 5-star reviews26 total 4-star reviews8 total 3-star reviews2 total 2-star reviews0 total 1-star reviews
152 Reviews
Reviews for similar products
5 out of 5 stars rating
By Karina B.March 18, 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
Loved how everything came out. Printing came out good.. even with not great picture ...
from zazzle.com (US)
5 out of 5 stars rating
By Kim G.September 1, 2022Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
It turned out great and looks awesome on my niece's wedding bouquet. I ended up taking off the ring and used twine to tie it on as a charm. She will be so touched by this charm. It looks exactly like what was shown online. It was a little bigger than I had imagined, but perfect! The printing is gorgeous! The quality is great! Thanks!
from zazzle.com (US)
5 out of 5 stars rating
By Tisha M.September 27, 2023Verified Purchase
Zazzle Reviewer Program
I was happy with the quality of the keychain. It is durable. The picture on the keychain turned out wonderful and clear.
from zazzle.com (US)

Tags

Keychains
catkittybrideweddingrosesveilmarriagewhitepinkkeychain
All Products
catkittybrideweddingrosesveilmarriagewhitepinkkeychain

Other Info

Product ID: 146610138077620901
Designed on 2007-07-23, 1:28 PM
Rating: G