Tap / click on image to see more RealViewsTM
CA$29.00
per mug
 

Kingfisher Birds Wildlife Pond Animals Mug

Qty:
Classic Mug
+CA$1.65
+CA$3.20

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalize your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Kingfisher Birds Wildlife Pond Animals Mug

Kingfisher Birds Wildlife Pond Animals Mug

Gorgeous collage of vintage botanical fine art of exotic Kingfisher Birds and pond habitat by Gould is on this Mug. Images are public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating22.5K Total Reviews
19865 total 5-star reviews1908 total 4-star reviews339 total 3-star reviews154 total 2-star reviews237 total 1-star reviews
22,503 Reviews
Reviews for similar products
5 out of 5 stars rating
By Courtney V.December 17, 2020Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
Nana is going to love this gift from her granddaughter! Good quality mug. Photos turned out good, colours are true as expected!
1 out of 5 stars rating
By Keira B.August 7, 2025Verified Purchase
Classic Mug, 325 ml
I was originally happy about my purchase and Nana loved the gift. HOWEVER, the description specifically says that these are microwave and dishwasher safe, BUT the first time Nana put this mug in the dishwasher it was destroyed. Not impressed..
5 out of 5 stars rating
By Zoe J.February 4, 2018Verified Purchase
Zazzle Reviewer Program
I am very satisfied with the quality of this product. The printing of the image on the mug was absolutely perfect and the quality of the mug itself was very good as well. I would recommend this product to anyone. I am very pleased with how the printing on the mug turned out. The image was clear, not blurry at all, and easy to see. I would recommend this product to anyone.
Original product

Tags

Mugs
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage
All Products
mugcoffee mugbirdswildlifeanimalskingfisherpondgouldvintage

Other Info

Product ID: 168527610128357298
Designed on 2016-10-11, 2:11 AM
Rating: G