Tap / click on image to see more RealViewsTM
CA$27.50
per towel
 

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Kitchen Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Kingfisher Bird Pond Wildlife Animal Kitchen Towel

Cool collage of vintage botanical fine art of Kingfisher Alcedo Birds and Cattails at a pond is on this Kitchen Towel. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1042 total 5-star reviews121 total 4-star reviews39 total 3-star reviews14 total 2-star reviews16 total 1-star reviews
1,232 Reviews
Reviews for similar products
5 out of 5 stars rating
By a.December 31, 2021Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
I was actually surprised by the quality. The material feels like it can handle the wash and the print seems to be set deep in the fibers. BUT I have not washed it yet. The printing was accurate and looks like it can handle washing.
5 out of 5 stars rating
By Pamela B.September 22, 2019Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Supper quality, quick Delivery people love them. Perfect, the quality and colour are wonderful
5 out of 5 stars rating
By Jil M.October 12, 2022Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Wow, I thought the fabric might have been hard and scratchy, but it's super soft, brilliant idea to have in a MCM kitchen! Colours are true to their photos on Zazzle, they are perfect!

Tags

Kitchen Towels
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds
All Products
birdswildlifeanimalskingfisherpondkitchen towelhand towelcattailswetlandskingfisher birds

Other Info

Product ID: 197316344225007716
Designed on 2019-07-14, 7:23 AM
Rating: G