Tap / click on image to see more RealViewsTM
CA$26.15
per pack of 50
 

Kids Playing Business Card

4.7 out of 5 stars rating
41245 Total Reviews
|
by
Qty:
  1. Size

  2. Corner Style

  3. Paper

Other designs from this category

About Business Cards

Sold by

Size: American, 89 mm x 51 mm

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 8.9 cm x 5 cm
  • Full colour CMYK print process
  • Double sided printing for no additional cost

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust colour and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection

About This Design

Kids Playing Business Card

Kids Playing Business Card

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating41.2K Total Reviews
34094 total 5-star reviews3984 total 4-star reviews1121 total 3-star reviews755 total 2-star reviews1291 total 1-star reviews
41,245 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lori B.May 18, 2022Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
The cards turned out lovely! Just enough colour and design to look good and be easy to read . Sturdy card stock as well. The soft pink watercolour looks really pretty on it! Printing is very nice. It’s clear and well designed
5.0 out of 5 stars rating
5 out of 5 stars rating
By Marie S.July 2, 2022Verified Purchase
Business Card, Size: Mighty, 89 mm x 64 mm,Paper: Signature Matte, Corners: Rounded
Zazzle Reviewer Program
I am so happy with these custom earring card backs. The process of designing then was easy and straightforward. There was an error with my initial order due and they refunded me and printed again right away. My cards are sleek, professional and perfect for my small business. They arrive promptly. I am very pleased to also be supporting other independent creatives like myself.. The print quality was exceptional!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jibril A.May 27, 2026Verified Purchase
Business Card, Size: American, 89 mm x 51 mm,Paper: Signature Matte, Corners: Squared
Thank you so much Zazzle was beautifully executed. And thank for the refund replacement. Appreciate it.

Tags

Business Cards
childrenkidskidplayingwhimiscaldoodlecutebusiness
All Products
childrenkidskidplayingwhimiscaldoodlecutebusiness

Other Info

Product ID: 240020705539831869
Designed on 2008-03-30, 8:15 AM
Rating: G