Tap / click on image to see more RealViewsTM
Sale Price CA$42.55.  
Original Price CA$50.05 per shirt
You save 15%

Keep Calm Plants Have Protein T-Shirt

Qty:
Basic Dark T-Shirt
-CA$2.35
+CA$16.65
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favourites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customize it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein

Customer Reviews

4.7 out of 5 stars rating32.8K Total Reviews
25692 total 5-star reviews4981 total 4-star reviews1121 total 3-star reviews506 total 2-star reviews488 total 1-star reviews
32,788 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Bob L.July 1, 2022Verified Purchase
Basic Dark T-Shirt, Black, Large
Zazzle Reviewer Program
They turned out exactly as we had hoped and we looked good even when we didn't bowl well. The printing was perfect and you can only see 9 pins on the shirt(the 5 pin hidden behind the headpin) which worked for us as we bowled in a 9 pin No-Tap league.
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousJune 23, 2025Verified Purchase
Basic Dark T-Shirt, Navy Blue, Small
The shirt I ordered was too small. I contacted Zazzle and they replaced it with a larger size. Very happy. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Toni D.November 6, 2022Verified Purchase
Basic Dark T-Shirt, Black, Small
Zazzle Reviewer Program
Great t-shirt!!! Quality is amazing and the colours are vibrant. Exactly how described!!! Can’t wait for my daughter to ask and give it to her confirmation sponsor. It’s also came earlier than I expected. Colours were exactly what I expected. The quality is amazing. The images couldn’t be any better. I’m very happy with his product and highly recommend it.

Tags

T-Shirts
plantsproteinkeepcalmhaveplantvegandieteatgift
All Products
plantsproteinkeepcalmhaveplantvegandieteatgift

Other Info

Product ID: 235340489353621483
Designed on 2022-04-26, 11:23 AM
Rating: G