Tap / click on image to see more RealViewsTM
CA$50.05
per shirt
 

Keep Calm Plants Have Protein T-Shirt

Qty:
Basic Dark T-Shirt
+CA$15.70
+CA$47.05
Black
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Basic Dark T-Shirt

Comfortable, casual and loose fitting, our heavyweight dark colour t-shirt will quickly become one of your favorites. Made from 100% cotton, it's unisex and wears well on anyone and everyone. We’ve double-needle stitched the bottom and sleeve hems for extra durability. Select a design from our marketplace or customize it to make it uniquely yours!

Size & Fit

  • Model is 188 cm and is wearing a medium
  • Standard fit
  • Garment is unisex sizing
  • Fits true to size

Fabric & Care

  • 100% cotton (Heathers are a cotton/poly blend)
  • Double-needle hemmed sleeves and bottom
  • Imported
  • Machine wash cold

About This Design

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein T-Shirt

Keep Calm Plants Have Protein

Customer Reviews

4.7 out of 5 stars rating32.4K Total Reviews
25349 total 5-star reviews4962 total 4-star reviews1098 total 3-star reviews493 total 2-star reviews458 total 1-star reviews
32,360 Reviews
Reviews for similar products
5 out of 5 stars rating
By Bob L.July 1, 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult L
Zazzle Reviewer Program
They turned out exactly as we had hoped and we looked good even when we didn't bowl well. The printing was perfect and you can only see 9 pins on the shirt(the 5 pin hidden behind the headpin) which worked for us as we bowled in a 9 pin No-Tap league.
5 out of 5 stars rating
By AnonymousJune 23, 2025Verified Purchase
Basic Dark T-Shirt, Navy Blue, Adult S
The shirt I ordered was too small. I contacted Zazzle and they replaced it with a larger size. Very happy. .
5 out of 5 stars rating
By Toni D.November 6, 2022Verified Purchase
Basic Dark T-Shirt, Black, Adult S
Zazzle Reviewer Program
Great t-shirt!!! Quality is amazing and the colours are vibrant. Exactly how described!!! Can’t wait for my daughter to ask and give it to her confirmation sponsor. It’s also came earlier than I expected. Colours were exactly what I expected. The quality is amazing. The images couldn’t be any better. I’m very happy with his product and highly recommend it.

Tags

T-Shirts
plantsproteinkeepcalmhaveplantvegandieteatgift
All Products
plantsproteinkeepcalmhaveplantvegandieteatgift

Other Info

Product ID: 235340489353621483
Designed on 2022-04-26, 11:23 AM
Rating: G