Tap / click on image to see more RealViewsTM
CA$34.40
per pillowcase
 

Hummingbird Birds Wildlife Flowers Pillowcase

Qty:
Standard
Single Pillowcase

Other designs from this category

About Pillowcases

Sold by

Set Size: Single Standard Size Pillowcase

Doze off in serious style with a one-of-a-kind pillowcase. Create a luxurious getaway with this super soft and cozy pillowcase. Counting sheep has never been easier, and sleep never ever felt soooo good.

  • Standard pillowcases, dimensions: 50.8 cm h x 76.2 cm w
  • Made from 100% soft microfiber polyester
  • High quality sublimation printing allows for vibrant color
  • Double-sided printing available for additional upcharge
  • Pillowcase is printed before being sewn, allowing for beautiful edge-to-edge printing
  • Machine wash/dry
  • Pillow not included
  • Proudly made in the USA

About This Design

Hummingbird Birds Wildlife Flowers Pillowcase

Hummingbird Birds Wildlife Flowers Pillowcase

Gorgeous collage of vintage botanical fine art of exotic tropical Hummingbird Birds and Flowers is on this Pillowcase. Image is public domain due to expired copyright. Collage is by me.

Customer Reviews

4.9 out of 5 stars rating231 Total Reviews
217 total 5-star reviews9 total 4-star reviews3 total 3-star reviews1 total 2-star reviews1 total 1-star reviews
231 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.December 31, 2019Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
I just wanted to come on here to say that the pillow case came out great , the size is perfect and the material is amazing. The printing of the photos as well was fantastic, it’s so clear and non - pixelated and I love it. Thank you zazzle !
5 out of 5 stars rating
By Mélanie N.December 11, 2019Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
Very good quality of product and printed design. The printing is very good. The colors are a little bit different from the picture but still very beautiful.
5 out of 5 stars rating
By D.November 10, 2020Verified Purchase
Single Pillowcase, Standard Size
Zazzle Reviewer Program
It's soft and really nice quality. I have ordered from this company several times over the past couple of years and it's always great! Thanks Zazzle. I ordered this customized King pillowcase. The first one had a little ink splattered on it, I reached out to the company and they immediately replaced it! The second one is perfect exactly what I wanted and expected.

Tags

Pillowcases
flowershummingbirdsbirdsanimalswildlifevintagepillowcasehummingbirds pillowcasetropicalfloral pillowcase
All Products
flowershummingbirdsbirdsanimalswildlifevintagepillowcasehummingbirds pillowcasetropicalfloral pillowcase

Other Info

Product ID: 256412253017643672
Designed on 2018-03-13, 7:09 AM
Rating: G