Vendre sur Zazzle
Tapez / cliquez sur l'image pour voir plus de RealViewsTM
22,70 $CA
Prix par boule à neige
 

happy new year 2026 rustic snow globe

par
Quantité :

A propos de Snow Globes

Vendu (e) par

Style: Boule à neige dôme

Les boules à neige photo sont une manière amusante et unique de mettre en valeur vos souvenirs préférés, ce qui en fait le cadeau parfait pour vos amis et votre famille. Il y a quelque chose de vraiment spécial dans un cadeau personnalisé fait avec amour.

  • Dimensions de la boule : environ 8,4 cm (L) × 8,4 cm (H)
  • Dimensions de l’image interne : environ 6 cm (L) × 7 cm (H)
  • Boule et socle en acrylique
  • Impression personnalisable sur 2 faces
  • Ce n’est pas un jouet. Recommandé pour les 14 ans et plus
  • Chaque boule contient environ 180ml d’eau, ce qui ne respecte pas les règles TSA pour les bagages à main.

À propos de ce design

happy new year 2026 rustic snow globe

happy new year 2026 rustic snow globe

This wreath motif would look charming inside a new year snow globe 2025. The glitter crystal new year globe feeling appears when you imagine it with snow. It can become a happy new year keepsake gift for nature lovers. The elegant new year snow ball mood matches the pinecones and stars. People enjoy a winter holiday collectible globe that feels peaceful. Overall it turns into a luxury new year gift globe with rustic style.

Avis des clients

Aucun commentaires sur ce produit pour le momentAvez-vous acheté ce produit ?

Tags

Snow Globes
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe
Tous les produits
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe

Autres infos

Identifiant du produit : 256442318044430840
Fabriqué le 2025-11-21 23:57
Évalué G