Tap / click on image to see more RealViewsTM
Sale Price CA$24.19.  
Original Price CA$28.45 per mug
You save 15%

Happy Bee Mug

Qty:
Combo Mug
-CA$3.55
-CA$1.75
Black

Other designs from this category

About Mugs

Sold by

Style: Combo Mug

Funny, unique, pretty, or personal, it's your choice for the perfect coffee mug. The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the rim & handle are vividly glazed in rich color. Match or complement the color of your existing dinnerware set, or gift your friend a mug in his or her favorite color.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug.
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Happy Bee Mug

Happy Bee Mug

A cute cartoon bee with a big happy smile waving hello. This is an original illustration by me (not clip art). The motif is repeated on both sides of the mug.

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19652 total 5-star reviews1902 total 4-star reviews325 total 3-star reviews141 total 2-star reviews210 total 1-star reviews
22,230 Reviews
Reviews for similar products
5 out of 5 stars rating
By Cathy O.May 1, 2019Verified Purchase
Combo Mug, 325 ml
Creator Review
Love this mug! Zazzle does such a GREAT job - it's shiny, and pretty, and really shows off the whimsical artwork extraordinarily well. You really can't tell how awesome it's going to be until you hold it in your hands. My new favourite mug! The printing was clear, sharp, and beautiful. Really showcased the artwork in true colours. Excellent craftmanship! Couldn't be happier.
5 out of 5 stars rating
By Heidy G.February 10, 2025Verified Purchase
Classic Mug, 325 ml
Colors just as bright as shown on-line. Would be nice if the colour choices for interior & handle on the large mug were as many as on the smaller one.
5 out of 5 stars rating
By Tina M.June 3, 2024Verified Purchase
Two-Tone Mug, 325 ml
This mug exceeded expectations! The quality is great and the prints turned out clear and crisp. The shipping also came in way faster than anticipated! All in all, very worth it! Thank you! The image quality was great!

Tags

Mugs
beehappycutehoneybumbleflywaspinsectwildlifeanimals
All Products
beehappycutehoneybumbleflywaspinsectwildlifeanimals

Other Info

Product ID: 168668466921023645
Designed on 2009-01-14, 3:41 PM
Rating: G