Tap / click on image to see more RealViewsTM
CA$56.80
per shirt
 

Guardian Ancestor Hypatia, Women's T-Shirt

Qty:
Womens Basic T-Shirt
Black
Classic Printing: No Underbase
-CA$11.25
-CA$11.25
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia, Women's T-Shirt

Guardian Ancestor Hypatia of Alexandria T-Shirt By Cherry Hill Seminary www.CherryHillSeminary.org Image Credit: "Hypatia by Julius Kronberg, 1889" (public domain) (BusDM)

Customer Reviews

4.6 out of 5 stars rating15.1K Total Reviews
10703 total 5-star reviews2907 total 4-star reviews839 total 3-star reviews389 total 2-star reviews256 total 1-star reviews
15,094 Reviews
Reviews for similar products
5 out of 5 stars rating
By Pam S.October 12, 2025Verified Purchase
Gave it to my daughter as a gift. She loved it. Next time I would order it on white for a crisper image.
Original product
5 out of 5 stars rating
By M.February 6, 2023Verified Purchase
Womens Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
I like that this turned out exactly as I had hoped. My daughter was missing her father (he passed away recently), and this picture of her with him delighted her! The print job was excellent and the colors were true to the original.
5 out of 5 stars rating
By Diana W.June 6, 2021Verified Purchase
Womens Basic T-Shirt, White, Adult S
Zazzle Reviewer Program
It came on time and as described. The fit is perfect and I like the quality as well. I love it and #OrangePillPod Telegram group loves it too :). Print was a bit lighter than expected, but that doesn't bother me at all.

Tags

All Products
paganpaganismmagickmagicwitchcraftwiccafaithreligionspiritualityseminary

Other Info

Product ID: 256365616848291214
Designed on 2025-03-28, 4:19 AM
Rating: G