Tap / click on image to see more RealViewsTM
CA$65.10
per clock
 

Green Woman - Wood Large Clock

Qty:
27.3 cm Acrylic
-CA$7.50
-CA$7.25
-CA$7.25
-CA$7.25

Other designs from this category

About Wall Clocks

Sold by

Style: 27.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.3 cm diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

Green Woman - Wood Large Clock

Green Woman - Wood Large Clock

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolizing her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.7 out of 5 stars rating3.5K Total Reviews
2916 total 5-star reviews393 total 4-star reviews80 total 3-star reviews44 total 2-star reviews67 total 1-star reviews
3,500 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By John B.December 31, 2023Verified Purchase
Wall Clock, 27.3 cm Acrylic
Zazzle Reviewer Program
Thos is a great clock. Unlike the last Hockey Night in Canada clock, there is no second time that ticks. With this, the hands change automatically, and when I need to adjust the time, I would move the hand. The clock has the famous Hockey Night in Canada logo with a blue background. Similar to the logo that is shown on Hockey Night in Canada!
4.0 out of 5 stars rating
4 out of 5 stars rating
By Linda O.August 22, 2022Verified Purchase
Wall Clock, 27.3 cm Acrylic
Zazzle Reviewer Program
Great product! Exactly what I expected! Printing was good quality!
5.0 out of 5 stars rating
5 out of 5 stars rating
By jena O.December 11, 2022Verified Purchase
Wall Clock, 20.3 cm Acrylic
Zazzle Reviewer Program
This was the perfect gift and it turned out amazing ! Highly recommend . Picture quality is great

Tags

Wall Clocks
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca

Other Info

Product ID: 256686808927638609
Designed on 2025-04-23, 10:32 AM
Rating: G