Tap / click on image to see more RealViewsTM
CA$3.70
per button
 

Green Woman - Wood 1 Inch Round Button

Qty:
Round Button
+CA$3.05
+CA$1.20
Small, 1¼ Inch

Other designs from this category

About badges

Sold by

Shape: Round Button

With Zazzle badges buttons, you can do more than just express a political opinion. Since you can add your own designs, pictures, and text, you can express just about anything you can think of. Start creating amazing flair today!

  • Available in 5 sizes from 3.18 cm to 15.24 cm diameter
  • Covered with scratch and UV-resistant Mylar
  • Square buttons available too
  • Made in the U.S.A.
  • This product contains a functional sharp point. Not for children under 3 years of age

About This Design

Green Woman - Wood 1 Inch Round Button

Green Woman - Wood 1 Inch Round Button

A Green Woman carved in wood with paint applied to the oak leaves and hair. Also known as a foliate head, the Green Man/Wild Man, is a motif in architecture and art, a face composed of, or completely surrounded by, foliage, most often spreading out from the centre of the face. Apart from a purely decorative function, the Green Man is interpreted as a symbol of rebirth, representing the cycle of new growth that occurs every spring. Found in many cultures from many ages around the world, the Green Man is often related to natural vegetation deities. The female equivalent of the Green Man is often referred to as the Green Woman or the Sheela-Na-Gig. These figures. often depicted with a leafy crown or luxuriant hair, symbolizing her connection to the natural world, are associated with fertility, nature, and the wild. In some contexts, the "Wild Woman" or the "Glaistig" (a type of sea spirit in Scottish folklore) can also be considered female equivalents of the Green Man, representing different aspects of nature's wildness and power.

Customer Reviews

4.8 out of 5 stars rating8.5K Total Reviews
7641 total 5-star reviews638 total 4-star reviews135 total 3-star reviews54 total 2-star reviews66 total 1-star reviews
8,534 Reviews
Reviews for similar products
5 out of 5 stars rating
By Simone V.March 12, 2019Verified Purchase
Round Button, Standard, 2¼ Inch
Creator Review
Excellent Quality! Better than my expectations! I Loved the print colors, very similar to the website.
5 out of 5 stars rating
By Mr J.September 21, 2020Verified Purchase
Round Button, Small, 1¼ Inch
Zazzle Reviewer Program
I was over the moon excited when i saw that zazzle was carrying merchandise that related to a fantastic t.v. series Orphan Black - i am a huge fan of the show and of the one character - and being an openly gay male it is just a fun thing to say - i have taken the button and put it on my rainbow pride face mask. i was very pleased with the printing on the pin
5 out of 5 stars rating
By John P.June 26, 2021Verified Purchase
Round Button, Standard, 2¼ Inch
Zazzle Reviewer Program
Excellent quality & design from Zazzle provided artwork on 3" badge. Amazing 4 day delivery from order to receipt in Vancouver BC. Crystal clear image & print as expected.

Tags

badges
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca
All Products
nature religiongoddessgreen womangreen manwild manfertilitymedievalpaganwicca

Other Info

Product ID: 256305253868111648
Designed on 2025-04-23, 9:56 AM
Rating: G