Tap / click on image to see more RealViewsTM
CA$11.15
per set of 6 labels
 

Green Watercolor Wedding Table Number Wine Label

Qty:
Wine Bottle Label (3.5" x 4")
-CA$1.85
-CA$3.75
+CA$7.50
+CA$7.50
+CA$7.50
+CA$7.50
+CA$7.50

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label (3.5" x 4")

Easily customise a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties and birthday parties.

  • Dimensions: 8.9 cm x 10.1 cm; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-colour, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 8.9 cm x 10.1 cm. For best results please add a 3 mm bleed.

About This Design

Green Watercolor Wedding Table Number Wine Label

Green Watercolor Wedding Table Number Wine Label

Make a statement at your wedding or event tables with our beautiful green watercolor table number wine labels. The design features a delicate watercolor motif in shades of green, adding a natural and elegant touch to your table setting. The labels are fully customizable. These table number labels are perfect to put on wine bottles, or any other beverage, as a way to indicate table numbers. These table number labels are printed on high-quality, waterproof and adhesive material, making it easy to stick and display on your bottles. Impress your guests with our stunning green watercolor table number wine labels at your special event.

Customer Reviews

4.9 out of 5 stars rating647 Total Reviews
598 total 5-star reviews29 total 4-star reviews4 total 3-star reviews6 total 2-star reviews10 total 1-star reviews
647 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.April 14, 2020Verified Purchase
Wine Bottle Label (3.5" x 4")
Zazzle Reviewer Program
These wine bottle labels came out just perfect and even better in person. You won’t be disappointed and working with the labels were so easy. They stick easily and firmly on the bottles with no issues of application. The best part is how stunning it looks on the wine bottles! Printing was beautiful with no bleeding and colours were clear and exactly how it was pictured!
5 out of 5 stars rating
By K.July 4, 2021Verified Purchase
Wine Bottle Label (3.5" x 4")
Zazzle Reviewer Program
High quality, sharp. And zazzle does a great job at meeting your shipping requests/needs!! Good quality printing.
5 out of 5 stars rating
By amanda c.March 20, 2023Verified Purchase
Mini Sparkling Wine Bottle Labels (7.6 cm x 5.1 cm)
Zazzle Reviewer Program
I absolutely love this. I was able to screenshot the background from my daughters invitations and create this wonderful label for the olive oil bottles that I will be giving away as party favors. I recommend it. Exactly how I designed it.

Tags

Food and Beverage Label Sets
greenelegantbohocalligraphyweddingfancydarkclassicfairytale
All Products
greenelegantbohocalligraphyweddingfancydarkclassicfairytale

Other Info

Product ID: 256730755502215084
Designed on 2023-01-27, 7:57 AM
Rating: G