Tap / click on image to see more RealViewsTM
CA$50.60
per binder
 

Grandma's Recipe Cookbook Purple Floral Greenery Binder

Qty:
Enter Information
2.54 cm Paper Capacity
+CA$4.50

Other designs from this category

About folders

Sold by

Size: Avery Signature 2.5 cm Binder

You’ve spent time crafting interesting reports, so why not create an eye-catching Avery custom binder to match? Showcase your business with custom client binders, proposals and reports, or design unique wedding albums, recipe books and photo albums.

  • Dimensions: 25.4 cm w x 29.84 cm l; Spine: 3.55 cm
  • 3-ring binder designed for letter (21.59 cm x 27.94 cm) sized paper
  • 2.54 cm capacity, fits 275 pages with 1 Touch™ EZD™ Rings
  • Full bleed photo-quality printing
  • Binder inserts not included
WARNING: This product contains functional sharp points and pinch point hazards. Not for children under 8 years of age. Use with adult supervision.

Ring Type: One Touch EZD™ Ring

2.5 cm Capacity: 275 pages
3.8 cm Capacity: 400 pages
5.1 cm Capacity: 540 pages
Locking rings open with ease and keep pages secure.

About This Design

Grandma's Recipe Cookbook Purple Floral Greenery Binder

Grandma's Recipe Cookbook Purple Floral Greenery Binder

Customized "Grandma's secret holiday recipes" binder keepsake cookbook with beautiful purple watercolor flowers and greenery. This is a perfect cookbook to collect grandma's favourite recipes put them into one collection. This would make a beautiful gift from a grandmother to her daughters or granddaughters. Recipes written in her own handwriting to pass down for generations to come will be a special gift that they will not soon forget.

Customer Reviews

4.8 out of 5 stars rating1.6K Total Reviews
1364 total 5-star reviews155 total 4-star reviews33 total 3-star reviews23 total 2-star reviews19 total 1-star reviews
1,594 Reviews
5 out of 5 stars rating
By JoAnne V.April 26, 2023Verified Purchase
Avery Signature Binder, 2.54 cm Paper Capacity
Zazzle Reviewer Program
This 2 ring binder is just perfect for what I was searching for as a unique shower gift for my grand niece. The guests for her bridal shower have been requested to submit a favorite family recipe. I am typing each one in a uniform way that is easy to read and follow. I have recipes from the future brides grandmothers and aunts that are difficult to replace. The binder is lovely and I ordered a matching apron with the same flower motif,. Hopefully, it will be a treasured family keepsake. The design is perfect and just what I selected.
from zazzle.com (US)
Reviews for similar products
5 out of 5 stars rating
By Barbara S.September 16, 2021Verified Purchase
Avery Signature Binder, 3.81 cm Paper Capacity
Zazzle Reviewer Program
It was fun to personalize it! Can be for any occasion! The watercolor design is so colorful & perfect for my tropical Florida cookbook. Thank you for the beautiful product & ultra fast shipping.....thinking Christmas gifts now! Beautiful, vibrant colors.
from zazzle.com (US)
5 out of 5 stars rating
By Jacqueline O.December 24, 2021Verified Purchase
Avery Signature Binder, 2.54 cm Paper Capacity
Zazzle Reviewer Program
A gift for my best friend from childhood. The personalization was an excellent feature. The colors looked exactly as I expected. Printing was perfect.

Tags

folders
grandmas secret holiday recipescookbookpurple watercolor floralflowersgreeneryspringtimekeepsakegifts for the kitchengifts for the cook
All Products
grandmas secret holiday recipescookbookpurple watercolor floralflowersgreeneryspringtimekeepsakegifts for the kitchengifts for the cook

Other Info

Product ID: 127581045843596519
Designed on 2021-04-19, 8:28 AM
Rating: G