Tap / click on image to see more RealViewsTM
CA$12.20
per set of 3 sheets
 

God Speed Edmund Leighton Fine Art Medieval Wrapping Paper Sheet

Qty:

Other designs from this category

About Wrapping Paper Sheet Sets

Sold by

Size: 48 cm x 73 cm

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customizable! Mix and match designs to create unique combinations
  • Dimensions: (3) 48 cm x 73 cm sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

God Speed Edmund Leighton Fine Art Medieval Wrapping Paper Sheet

God Speed Edmund Leighton Fine Art Medieval Wrapping Paper Sheet

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
1039 total 5-star reviews56 total 4-star reviews21 total 3-star reviews4 total 2-star reviews25 total 1-star reviews
1,145 Reviews
Reviews for similar products
5 out of 5 stars rating
By Michelle P.October 21, 2023Verified Purchase
Zazzle Reviewer Program
Interesting subject matter,very creative,, the printed paper is so clear, nice weight easy to work with for artistic endeavours. The printing is just perfection,on all 3 poster pages.here ere a couple pics of what I created.I hope this will give an idea of the high quality Iam talking about.
Original product
5 out of 5 stars rating
By Michelle P.October 21, 2023Verified Purchase
Zazzle Reviewer Program
Really good looking prints, I have used 1.5 of them,creating new art for my living room. I have sent a couple pics. Excellent printing on these. The colors are so vivid and clear, the feathers are like real life. There is never any transfer of dye when using for decoupage.
Original product
5 out of 5 stars rating
By Michelle P.October 21, 2023Verified Purchase
48 cm x 73 cm Wrapping Paper Sheets, Matte 48.26 cm x 73.66 cm
Zazzle Reviewer Program
Good paper to work with on art projects of any kind. I have more paper , to use yet for another decoupage. Superb printing on these African prints. The metallic parts came out wonderfully,the teal color is very rich.

Tags

Wrapping Paper Sheet Sets
All Products
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse

Other Info

Product ID: 256420946038786223
Designed on 2023-08-04, 1:18 AM
Rating: G