Tap / click on image to see more RealViewsTM
CA$40.60
per planner
 

God Speed Edmund Leighton Fine Art Medieval Planner

Qty:
Enter Information
Black

Other designs from this category

About Planners

Sold by

Size: Standard (21.6 cm x 27.9 cm)

It's time to get organised! Plan your days in style with the help of a customisable planner. Perfect for your busy lifestyle, this planner has a place to plan your months, plan your weeks, and write down everything that's important to you!

  • Dimensions: 21.59 cm x 27.94 cm
  • One sheet of fun and colourful repositionable stickers in back (shown)
  • Includes monthly and weekly layouts, 12 months, 60 pages
  • Softcover front and back covers laminated
  • Wire-o® spiral spine available in three colour options
Fully committed to providing high quality and safe products, this product is Consumer Product Safety Improvement Act (CPSIA) compliant. Tracking label available on inside back cover.

About This Design

God Speed Edmund Leighton Fine Art Medieval Planner

God Speed Edmund Leighton Fine Art Medieval Planner

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating283 Total Reviews
248 total 5-star reviews25 total 4-star reviews2 total 3-star reviews3 total 2-star reviews5 total 1-star reviews
283 Reviews
Reviews for similar products
5 out of 5 stars rating
By Elena F.December 30, 2022Verified Purchase
Standard (21.6 cm x 27.9 cm), Soft Cover, Gold Spiral Planner
Zazzle Reviewer Program
I love this planner. It is glossy, so you can wipe it down if you spill on it. I tend to eat at my desk a lot. It is sturdy enough that I can write in it on my lap at times. The front is inspiring and the back has my store QR codes and other info I want to show someone quickly all in one place. It is large enough to write quite a bit of information in. Also, you can tuck in loose pages here and there as necessary and it still looks neat. I love this picture. I've purchased it before. The text is sharp. I love that I can customize the saying every year to what I want.
5 out of 5 stars rating
By KC K.August 30, 2023Verified Purchase
Standard (21.6 cm x 27.9 cm), Hard Cover, Gold Spiral Planner
Zazzle Reviewer Program
Solid outside cover, not flimsy at all. Paper qualify is outstanding & so much room available in the planner to organize my thoughts & plan out not only each month but also the weeks as well. Happy to see 2023 & 2024 year at a glance at the beginning of the planner. Many places to add notes & not affect the main calendar sections. Such a great product & love the design on both the front & back covers. So happy that the design & colours I chose for the personalization turned out better than I thought it would. Love that I was able to choose the coil colour as well as adjust the font colour to match the flower on the cover. So excited to use the stickers in the back of the planner, that was a nice surprise. Couldn't be happier with my purchase.
5 out of 5 stars rating
By Terra-Lee C.November 26, 2021Verified Purchase
Standard (21.6 cm x 27.9 cm), Soft Cover, Black Spiral Planner
Zazzle Reviewer Program
Love Love Love my planner!! It is sooo awesome to be able to be able to create and personalize s a product. Love the stickers that came with my planner. I get compliments everywhere I go.... Love You Zazzle!! Everything was exactly as I expected with the layout and printing!! Getting ready to create my planner for 2022...

Tags

Planners
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse

Other Info

Product ID: 256869878912485903
Designed on 2024-01-13, 12:00 AM
Rating: G