Tap / click on image to see more RealViewsTM
CA$27.60
per spiral notebook
 

God Speed Edmund Leighton Fine Art Medieval Notebook

Qty:
21.59 cm x 27.94 cm Deluxe Spiral Notebook
Wide Ruled
Black

Other designs from this category

About Spiral Notebooks

Sold by

Style: 21.59 cm x 27.94 cm Deluxe Spiral Notebook

Accessorize while you organize with these hand made spiral notebooks. The front and back covers are customizable with your images and text, and the notebook covers are laminated to ensure durability. Choose from 4 notebook styles, hardcover or softcover versions, 7 different spiral colors and 10 page design options to make your one-of-a-kind notebook today.

  • Dimensions: 21.6 cm l x 28 cm w
  • Hardcover or Softcover
  • Page Count: 60 sheets, 120 pages
  • 60 lb. durable text smooth paper
  • Laminated front and back covers, plain white inside
  • Choice of 7 colors for the spiral
  • Choice of 10 designs for the pages
  • CPSIA compliant
  • Suitable for ages 4+

About This Design

God Speed Edmund Leighton Fine Art Medieval Notebook

God Speed Edmund Leighton Fine Art Medieval Notebook

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating811 Total Reviews
731 total 5-star reviews58 total 4-star reviews6 total 3-star reviews3 total 2-star reviews13 total 1-star reviews
811 Reviews
Reviews for similar products
5 out of 5 stars rating
By Kendra M.January 6, 2025Verified Purchase
21.59 cm x 21.59 cm Deluxe Spiral Notebook, Black spiral, Wide Ruled pages
Absolutely beautiful! It’s more stunning in person. Amazing quality from the hardcover (images/font) to the pages. I love it! 😍 I will definitely order again in the future and I highly recommend any potential buyers to purchase. You won’t be disappointed. Thank you Zazzle. .
1 out of 5 stars rating
By Kelly A.June 20, 2024Verified Purchase
21.59 cm x 27.94 cm Deluxe Spiral Notebook, Black spiral, Wide Ruled pages
Although the product is what I expected (it's a notebook), the packaging for delivery was done poorly, and the notebook arrived bent, enough so that I am not comfortable giving it as the gift it was intended to be. The quality of the picture and design is lovely, but again, because it arrived bent, it is rather skewed.
5 out of 5 stars rating
By Elena F.December 8, 2022Verified Purchase
13.97 cm x 21.59 cm Deluxe Spiral Noteboook, Black spiral, College Ruled pages
Zazzle Reviewer Program
This journal came in within a week of ordering it and I was thrilled! I love roses so I love having this journal. The size is perfect. Small enough to throw in a bag. The printing is clear. The pages are nice and thick. The binding is sturdy. The printing is a little darker than the photo on screen but that is expected with printing. It looks luxurious to me. I love deep red roses.

Tags

Spiral Notebooks
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse

Other Info

Product ID: 256225330556941399
Designed on 2023-08-01, 7:35 AM
Rating: G