Tap / click on image to see more RealViewsTM
CA$7.75
per magnet
 

God Speed Edmund Leighton Fine Art Medieval Magnet

Qty:
Rectangle Magnet
-CA$2.85
-CA$2.05
6.4 cm x 8.9 cm

Other designs from this category

About Magnets

Sold by

Shape: Rectangle Magnet

Your refrigerator called and said it was feeling mighty lonely. Why not give it a few friends to play with by creating a couple of custom magnets! Add your favorite image to a round magnet, or shop the thousands of options for a cool square magnet.

  • Available in 8.9 cm x 6.4 cm or 6.4 cm x 8.9 cm
  • USA Made with recycled domestic steel
  • Smooth glossy mylar finish
  • Printed on FSC Certified recycled paper stock

About This Design

God Speed Edmund Leighton Fine Art Medieval Magnet

God Speed Edmund Leighton Fine Art Medieval Magnet

Edmund Leighton - God Speed. Oil on Canvas. Year: 1900, Public domain.

Customer Reviews

4.8 out of 5 stars rating7K Total Reviews
6181 total 5-star reviews578 total 4-star reviews120 total 3-star reviews45 total 2-star reviews37 total 1-star reviews
6,961 Reviews
Reviews for similar products
5 out of 5 stars rating
By Delores C.August 13, 2025Verified Purchase
Magnet, Style: Rectangle Magnet, Size: 6.4 cm x 8.9 cm
Creator Review
The magnet is sturdy and bright and the print quality is great! .
from zazzle.com (US)
5 out of 5 stars rating
By Delores C.August 13, 2025Verified Purchase
Magnet, Style: Rectangle Magnet, Size: 6.4 cm x 8.9 cm
Creator Review
The magnet is sturdy and bright and the print quality is great! .
from zazzle.com (US)
5 out of 5 stars rating
By Delores C.August 13, 2025Verified Purchase
Magnet, Style: Rectangle Magnet, Size: 8.9 cm x 6.4 cm
Creator Review
The magnet is sturdy and bright and the print quality is great! .
from zazzle.com (US)

Tags

Magnets
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse
All Products
leightonwarknightmaidenmedievalfantasyfine artlovecastlehorse

Other Info

Product ID: 256868322552475579
Designed on 2023-08-01, 7:12 AM
Rating: G