Tap / click on image to see more RealViewsTM
CA$83.55
per case
 

Glitch uncle friendly cubimal Case-Mate iPhone case

Qty:
  1. Phone Model

  2. Style

Other designs from this category

About Casemate Cases

Sold by

Style: Case-Mate Tough Apple iPhone 11 Case

Simple, but tough. Contoured to fit the sleek curves of the iPhone, this Case-Mate case features a hard shell plastic exterior and shock absorbing liner to protect your device.

  • Designed for the Apple iPhone 11
  • Shock absorbing flexible liner for an added layer of protection
  • Impact resistant, durable hard plastic
  • Case will not interfere with wireless charging
  • Lay-flat bezel to protect your screen from directly contacting surfaces
  • Access to all ports, controls & sensors
  • Customize with your images, designs and text
  • Glossy finish
  • Printed in the USA

About This Design

Glitch uncle friendly cubimal Case-Mate iPhone case

Glitch uncle friendly cubimal Case-Mate iPhone case

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.7 out of 5 stars rating6.6K Total Reviews
5289 total 5-star reviews844 total 4-star reviews212 total 3-star reviews119 total 2-star reviews132 total 1-star reviews
6,596 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lawana H.January 29, 2022Verified Purchase
Zazzle Reviewer Program
It was very nice the pictures were placed the way i put them. the printing was fine
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan g.July 31, 2025Verified Purchase
Case-Mate Phone Case, Apple iPhone 11, Tough
Creator Review
I purchased this waterfall photo case as a birthday gift. The design was created from one of my images, and my friend loved it. This case is well-suited for individuals who find the sight of flowing water to be calming, as he found the vision therapeutic. It proved to be a perfect gift for someone who already has everything.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By VickiAugust 9, 2021Verified Purchase
Zazzle Reviewer Program
I received the cell phone case on the promised date. I loved the detail, colors, and the dragonfly on the case. The colors are vibrant and the details of the dragonfly were wonderful. Have received many compliments on the case.
from zazzle.com (US)
Original product

Tags

unclefriendlycubimalglitchglitchenwetdryvacglitchthegametinyspeck

Other Info

Product ID: 179874815035578614
Designed on 2013-11-23, 5:48 PM
Rating: G