Tap / click on image to see more RealViewsTM
CA$8.20
per card
 

Glitch rube cubimal

Qty:
Choose Your Format
Signature Matte
  • 17 pt thickness / 120 lb weight
  • Light white, uncoated matte finish with an eggshell texture
+CA$1.15
+CA$1.15
-CA$0.35

About Cards

Sold by

Size: Standard (12.7 cm x 17.8 cm)

Birthdays or holidays, good days or hard days, Zazzle’s customised greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 12.7 cm x 17.8 cm (portrait) or 17.8 cm x 12.7 cm (landscape)
  • Full colour CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 7.62 cm x 10.16 cm (portrait) or 10.16 cm x 7.62 cm (landscape)
  • Blank white envelopes included

Paper Type: Matte

The most popular paper choice, Matte’s eggshell texture is soft to the touch with a smooth finish that provides the perfect backdrop for your chosen designs.

  • Light white, uncoated matte finish with an eggshell texture
  • Paper is easy to write on and won't smudge

About This Design

Glitch rube cubimal

Glitch rube cubimal

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.9 out of 5 stars rating7.4K Total Reviews
6792 total 5-star reviews487 total 4-star reviews71 total 3-star reviews28 total 2-star reviews39 total 1-star reviews
7,417 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kim B.January 21, 2019Verified Purchase
Zazzle Reviewer Program
You guys did an excellent job on my memorial cards of my beloved pet name Bailey. Thank you so so very much. It was absolutely perfect. Printing was absolutely stunning. Thank you for helping cherish this forever!!
5.0 out of 5 stars rating
5 out of 5 stars rating
By penny m.December 26, 2023Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Grandkid was surprised that his name was in print. It brought a smile to his face. Quality was surpurb. was exactly as shown.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ravi D.January 4, 2023Verified Purchase
Folded Card, Size: Standard (12.7 cm x 17.8 cm), Paper: Signature Matte
Zazzle Reviewer Program
Zazzle did a fantastic job with both creativity and delivery as product was received on time and many students kids and adults loved their cards. Highly recommended. Thanks Zazzle and look forward to the future cards and business. Clean, precise and accurate with details.

Tags

Cards
rubecubimalglitchglitchenwetdryvactinyspeckglitchthegame
All Products
rubecubimalglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 137686937994410458
Designed on 2013-11-23, 5:46 PM
Rating: G