Tap / click on image to see more RealViewsTM
CA$74.05
per clock
 

Glitch: limited edition imitation grichmas yeti round clock

Qty:
20.3 cm Acrylic
+CA$9.60
+CA$9.60
+CA$0.30
+CA$0.30
+CA$0.30

Other designs from this category

About Wall Clocks

Sold by

Style: 20.3 cm Round Acrylic Wall Clock

Customise your wall clock to create a functional wall décor statement piece to perfectly match your home décor, show off your art or favourite photo, or give as a personalised gift. This unique, high-quality wall clock is vibrantly printed with AcryliPrint®HD process and features a pre-installed backside hanging slot for easy hanging and a non-ticking design.

  • 2 sizes: 20.32 cm diameter or 27.30 cm diameter
  • Material: Grade-A acrylic
  • One AA battery required (not included)
  • Add photos, artwork, and text
  • Indoor use only, not recommended for outdoor use

About This Design

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti round clock

Glitch: limited edition imitation grichmas yeti This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating3.5K Total Reviews
2916 total 5-star reviews393 total 4-star reviews81 total 3-star reviews44 total 2-star reviews67 total 1-star reviews
3,501 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By N.January 15, 2023Verified Purchase
Wall Clock, 27.3 cm Acrylic
Zazzle Reviewer Program
The site was very easy to navigate. You can customize each part of the design from colour, font to images. Very easy to use. I was amazed by the quality when it arrived. It looks perfect.. just like the image I created. Perfect addition to my son’s nursery. Highly recommend it! Printing turned out perfect. Just like the design. The colours and font all turned out great!
5.0 out of 5 stars rating
5 out of 5 stars rating
By T.September 27, 2020Verified Purchase
Wall Clock, 20.3 cm Acrylic
Zazzle Reviewer Program
Made In USA !! not in China !! very well done and beyond my expectations. I ordered 3 more right after receiving my first order
5.0 out of 5 stars rating
5 out of 5 stars rating
By jena O.December 11, 2022Verified Purchase
Wall Clock, 20.3 cm Acrylic
Zazzle Reviewer Program
This was the perfect gift and it turned out amazing ! Highly recommend . Perfect print quality

Tags

Wall Clocks
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame
All Products
limitededitionimitationgrichmasyetiglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 256753996524584946
Designed on 2014-10-03, 7:10 AM
Rating: G