Tap / click on image to see more RealViewsTM
CA$41.75
per apron
 

Glitch Lem Mask Standard Apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch Lem Mask Standard Apron

Glitch Lem Mask Standard Apron

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
1972 total 5-star reviews309 total 4-star reviews42 total 3-star reviews15 total 2-star reviews13 total 1-star reviews
2,351 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By a.January 4, 2022Verified Purchase
Apron, Long
Zazzle Reviewer Program
Very impressed with this item. The material seems to be of good quality (like thin canvas material) and the stitching. I'm confident that this will withstand many uses and washes. The printing turned out excellent. Sharp and detailed. Perfect material to have your message printed. Like how you can customize your message to anything you like.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rose A.May 21, 2021Verified Purchase
Zazzle Reviewer Program
The quality of this apron is exceptional; I was very pleasantly surprised considering the reasonable cost. The fabric is heavier than I expected and the overall construction is excellent. Colours and patterns were even nicer than depicted on the website when ordering.
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ginette H.November 19, 2018Verified Purchase
Apron, Standard
Zazzle Reviewer Program
Just received my aprons that are gifts doe good friends and I am impressed by the quality of print, the fabric and build of the aprons. The pocket at the bottom of the apron which is 24" lengthwise will be quite useful. Good job! Excellent. Nice colors and print.

Tags

Aprons
glitchglitchengiantgiantsmaskmaskslemwetdryvactinyspeckglitchthegame
All Products
glitchglitchengiantgiantsmaskmaskslemwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154897660550990101
Designed on 2013-11-23, 5:29 PM
Rating: G