Tap / click on image to see more RealViewsTM
CA$35.20
per mug
 

Glitch juju cubimal coffee mug

Qty:
  1. Style

  2. Size

Other designs from this category

About Mugs

Sold by

Style: Classic Mug

Give a made-to-order mug from Zazzle to someone special, or treat yourself to a design that brings you joy or makes you laugh. Create your own photo mug, shop our collection of the funniest joke mugs, personalize your mug with a monogram, or express yourself with one of our 10 million designs.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8” H
    • 15-ounce: 3.4” D x 4.5” H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Glitch juju cubimal coffee mug

Glitch juju cubimal coffee mug

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating22.8K Total Reviews
20096 total 5-star reviews1919 total 4-star reviews351 total 3-star reviews165 total 2-star reviews291 total 1-star reviews
22,822 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By DerekAugust 16, 2022Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
Replacement mug arrived today and in record time!! (The original one was damaged in shipping) The mug is in perfect condition. Thanks to Zazzle for excellent customer service. Derek. The printing is beautiful. A nicely inspired design.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jesmina B.January 7, 2024Verified Purchase
Classic Mug, 325 ml
Zazzle Reviewer Program
My order was on time, and looked exactly how it appeared on the order site. Printing is gorgeous and so far lasting really well.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kristie N.December 15, 2020Verified Purchase
Classic Mug, 444 ml
Zazzle Reviewer Program
I bought these mugs to give to my clients and people connected to my business and they have had great success. Very happy with the outcome, the service, and the product. Printing turned out great, colours with vibrant and product looks clear and professional. Happy with the results.

Tags

Mugs
jujucubimalglitchglitchenglitchthegamewetdryvactinyspeck
All Products
jujucubimalglitchglitchenglitchthegamewetdryvactinyspeck

Other Info

Product ID: 168410392749298043
Designed on 2013-11-23, 5:43 PM
Rating: G