Tap / click on image to see more RealViewsTM
CA$55.25
per shirt
 

Glitch emo bear cubimal T-Shirt

Qty:
Womens Basic T-Shirt
+CA$48.10
Black
Classic Printing: No Underbase
-CA$12.05
-CA$12.05
-CA$12.05
-CA$12.05
-CA$12.05
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch emo bear cubimal T-Shirt

Glitch emo bear cubimal T-Shirt

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.6 out of 5 stars rating15K Total Reviews
10646 total 5-star reviews2900 total 4-star reviews833 total 3-star reviews380 total 2-star reviews245 total 1-star reviews
15,004 Reviews
Reviews for similar products
5 out of 5 stars rating
By Pam S.October 12, 2025Verified Purchase
Gave it to my daughter as a gift. She loved it. Next time I would order it on white for a crisper image.
Original product
5 out of 5 stars rating
By M.February 6, 2023Verified Purchase
Womens Basic T-Shirt, White, Adult M
Zazzle Reviewer Program
I like that this turned out exactly as I had hoped. My daughter was missing her father (he passed away recently), and this picture of her with him delighted her! The print job was excellent and the colors were true to the original.
5 out of 5 stars rating
By Diana W.June 6, 2021Verified Purchase
Womens Basic T-Shirt, White, Adult S
Zazzle Reviewer Program
It came on time and as described. The fit is perfect and I like the quality as well. I love it and #OrangePillPod Telegram group loves it too :). Print was a bit lighter than expected, but that doesn't bother me at all.

Tags

T-Shirts
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame
All Products
glitchglitchenemobearcubimalwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235217361453915941
Designed on 2013-11-23, 5:39 PM
Rating: G