Tap / click on image to see more RealViewsTM
CA$67.75
per tie
 

Glitch Cthulhu Mask Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139.7 cm
    • Width: 10.2 cm (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

Glitch Cthulhu Mask Tie

Glitch Cthulhu Mask Tie

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1836 total 5-star reviews330 total 4-star reviews141 total 3-star reviews70 total 2-star reviews118 total 1-star reviews
2,495 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Margo N.July 8, 2023Verified Purchase
Tie
Zazzle Reviewer Program
That's exactly what I was expecting! I made a custom design and it looks so good. I will definitely recommend this shop and service for my friends. Good quality. Exactly like in the photo.
1.0 out of 5 stars rating
1 out of 5 stars rating
By L.January 22, 2026Verified Purchase
Tie
The tie was shown as being black and white on the website but unfortunately it is green and white once I received it. This is false advertisement and I am reporting it. I want my money back. I'm willing to return the tie. It's no good. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Laura V.August 16, 2020Verified Purchase
Tie
Zazzle Reviewer Program
I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much!! The printing is not raised and the tie is silky smooth. It turned out exactly as I designed it!

Tags

Ties
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 151799404367149809
Designed on 2013-11-23, 5:27 PM
Rating: G