Tap / click on image to see more RealViewsTM
CA$22.90
per notebook
 

Glitch Cthulhu Mask Notebook

Qty:

Other designs from this category

About Notebooks

Sold by

Style: 16.51 cm x 22.22 cm Classic Notebook

Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

  • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
  • Cover printed in vibrant, sharp colour
  • 80 black & white lined pages
  • College ruled
  • Lay flat spiral binding
This product is recommended for ages 8+..
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

About This Design

Glitch Cthulhu Mask Notebook

Glitch Cthulhu Mask Notebook

Once upon a time, the Vac was a player on Glitch – possibly the very best game it’s ever invested in, bar none. Glitch closed its doors in 2012, and the vac bloody wept. Great game, great community, and the Vac misses you all like crazy. Community’s still going strong, incidentally – you guys rock. 2013, and TinySpeck.com – the good folks behind Glitch – released their entire archive, other than logo, to the public domain. You can learn about that over here: http://www.glitchthegame.com/public-domain-game-art/ That being the case, the Vac decided there needed to be Glitch stuff available to the world, so as it has time, it’s systematically working its way through the archives and making things available here for purchase. Everything here is public domain, and used with more gratitude than the Vac can possibly describe. Thank-you TinySpeck.com and Slack.com for doing this. Thank-you GlitchTheGame.com as well. Glitchen, here you go, and if you've requests for stuff you can't find, yell - I'll do my best to provide. Don't forget that on many products you can change image size, add text, change style, and change background colour by clicking customize. -Wetdryvac / Wetdryvac.net

Customer Reviews

4.8 out of 5 stars rating1.8K Total Reviews
1527 total 5-star reviews188 total 4-star reviews42 total 3-star reviews27 total 2-star reviews15 total 1-star reviews
1,799 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By ana g.March 1, 2019Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
I got these for my 2 girls because they love little monsters, so they could use it for notes for school. They loved them :). Printing was as shown (very good).
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnnMarie P.January 16, 2023Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
I ordered this for a colleague who was recently promoted to Principal. The quality was excellent and the product arrived shortly after submitting the order. The look of the cover is terrific. Printing was clear and the lettering looked great. Personalized name was spelled correctly.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nancy E.March 4, 2018Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
I love journals and notebooks, so I was very excited to be able to order one using a piece of my artwork as the cover design. It turned out perfect, the quality is A+ and I would definitely order this product again. The print quality is superb. I can say this because the cover is my own digital design, so I have the original artwork to compare the colors. The colors are exact to the artwork. I am very impressed with the print quality and will be ordering more with different designs.

Tags

Notebooks
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame
All Products
glitchglitchenmaskmaskswetdryvactinyspeckcthulhuglitchthegame

Other Info

Product ID: 130910448210295268
Designed on 2013-11-23, 5:27 PM
Rating: G