Tap / click on image to see more RealViewsTM
CA$22.90
per notebook
 

Glitch: compounds diabolic acid notebook

Qty:

Other designs from this category

About Notebooks

Sold by

Style: 16.51 cm x 22.22 cm Classic Notebook

Organise your day with a custom notebook! Made with your images and text on the front cover, this notebook is a great way to show off your personal style and keep track of all important notes and appointments all at once.

  • Dimensions: 16.5 cm x 22.2 cm (6.5" x 8.75")
  • Cover printed in vibrant, sharp colour
  • 80 black & white lined pages
  • College ruled
  • Lay flat spiral binding
This product is recommended for ages 8+..
Creator Tip: To ensure the highest quality print, please note this product’s customisable design area measures 16.5 cm x 22.2 cm (6.5" x 8.75"). For best results please add 0.3 cm (1/8") bleed..

About This Design

Glitch: compounds diabolic acid notebook

Glitch: compounds diabolic acid notebook

Glitch: compounds diabolic acid This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.8K Total Reviews
1527 total 5-star reviews188 total 4-star reviews42 total 3-star reviews27 total 2-star reviews15 total 1-star reviews
1,799 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By ana g.March 1, 2019Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
I got these for my 2 girls because they love little monsters, so they could use it for notes for school. They loved them :). Printing was as shown (very good).
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnnMarie P.January 16, 2023Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
I ordered this for a colleague who was recently promoted to Principal. The quality was excellent and the product arrived shortly after submitting the order. The look of the cover is terrific. Printing was clear and the lettering looked great. Personalized name was spelled correctly.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nancy E.March 4, 2018Verified Purchase
16.51 cm x 22.22 cm Classic Notebook
Zazzle Reviewer Program
I love journals and notebooks, so I was very excited to be able to order one using a piece of my artwork as the cover design. It turned out perfect, the quality is A+ and I would definitely order this product again. The print quality is superb. I can say this because the cover is my own digital design, so I have the original artwork to compare the colors. The colors are exact to the artwork. I am very impressed with the print quality and will be ordering more with different designs.

Tags

Notebooks
compoundsdiabolicacidglitchglitchenwetdryvactinyspeckglitchthegame
All Products
compoundsdiabolicacidglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 130823130589919417
Designed on 2014-10-03, 8:42 AM
Rating: G