Tap / click on image to see more RealViewsTM
CA$33.40
per towel
 

Glitch: bubble tea kitchen towel

Qty:

Other designs from this category

About Kitchen Towels

Sold by

Style: Kitchen Towel 40.6 cm x 61 cm

Brighten up any kitchen with a set of new kitchen towels! Made of durable poly-blend, these towels are great for drying and will look vibrant with your text, monogram or artwork. Designed for a lifetime of use, these machine washable kitchen towels look great and clean up well, too!

  • Dimensions: 40.6 cm x 60.9 cm
  • Durable woven polyester / polyamide blend microfibre; 80% Polyester / 20% Polyamide
  • Machine washable
  • Made and shipped from the USA
Creator Tip: To ensure the highest quality print, please note that this product’s customisable design area measures 40.6 cm x 60.9 cm (16" x 24"). For best results please add 1.8 cm (5/7") bleed..

About This Design

Glitch: bubble tea kitchen towel

Glitch: bubble tea kitchen towel

Glitch: bubble tea This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.2K Total Reviews
1046 total 5-star reviews122 total 4-star reviews38 total 3-star reviews15 total 2-star reviews16 total 1-star reviews
1,237 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By a.December 31, 2021Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
I was actually surprised by the quality. The material feels like it can handle the wash and the print seems to be set deep in the fibers. BUT I have not washed it yet. The printing was accurate and looks like it can handle washing.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pamela B.September 22, 2019Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Supper quality, quick Delivery people love them. Perfect, the quality and colour are wonderful
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jil M.October 12, 2022Verified Purchase
Kitchen Towel
Zazzle Reviewer Program
Wow, I thought the fabric might have been hard and scratchy, but it's super soft, brilliant idea to have in a MCM kitchen! Colours are true to their photos on Zazzle, they are perfect!

Tags

Kitchen Towels
bubbleteaglitchglitchenwetdryvactinyspeckglitchthegame
All Products
bubbleteaglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 197307328647115818
Designed on 2014-10-03, 7:30 AM
Rating: G