Tap / click on image to see more RealViewsTM
CA$48.00
per tie
 

Glitch: artifact platinumium spork tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 139.7 cm
    • Width: 10.2 cm (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

Glitch: artifact platinumium spork tie

Glitch: artifact platinumium spork tie

Glitch: artifact platinumium spork This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1792 total 5-star reviews327 total 4-star reviews130 total 3-star reviews63 total 2-star reviews94 total 1-star reviews
2,406 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margo N.July 8, 2023Verified Purchase
Tie
Zazzle Reviewer Program
That's exactly what I was expecting! I made a custom design and it looks so good. I will definitely recommend this shop and service for my friends. Good quality. Exactly like in the photo.
5 out of 5 stars rating
By Laura V.August 16, 2020Verified Purchase
Tie
Zazzle Reviewer Program
I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much!! The printing is not raised and the tie is silky smooth. It turned out exactly as I designed it!
5 out of 5 stars rating
By Laura V.August 16, 2020Verified Purchase
Tie
Zazzle Reviewer Program
I was beyond thrilled with how this custom tie turned out. I applied my husband’s business name to it all over the place and it was beautifully produced, absolutely perfect. Silky, shiny, exactly as I designed it. The lettering was not raised which was my fear. It formed a part of the tie itself so it looked like it was supposed to be there! My husband loved it and I made 9 more in different designs. Produced very quickly, well packaged and arrived early! I loved this design so much and the print turned out so nice, exactly as I designed it and it was not raised, it looked as though it was part of the overall fabric itself! It was so cool!

Tags

Ties
artifactplatinumiumsporkglitchglitchenwetdryvactinyspeckglitchthegame
All Products
artifactplatinumiumsporkglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 151821879205526844
Designed on 2014-10-03, 7:30 AM
Rating: G