Tap / click on image to see more RealViewsTM
CA$128.00
per poster
 

Glitch: achievement maniacal foxbrusher poster

Qty:
Choose Your Format
Custom (72.81cm x 72.81cm)
None

Other designs from this category

About Posters

Sold by

Paper Type: Value Poster Paper (Semi-Gloss)

Your walls are a reflection of your personality, so let them speak with your favorite quotes, art, or designs printed on our custom Giclee posters! High-quality, microporous resin-coated paper with a beautiful semi-gloss finish. Choose from standard or custom size posters and framing options to create art that’s a perfect representation of you.

  • Gallery quality Giclee prints
  • Ideal for vibrant artwork and photo reproduction
  • Semi-gloss finish
  • Pigment-based inks for full-color spectrum high-resolution printing
  • Durable 185gsm paper
  • Available in custom sizing up to 152.4 cm
  • Frames available on all standard sizes
  • Frames include Non-Glare Acrylic Glazing

About This Design

Glitch: achievement maniacal foxbrusher poster

Glitch: achievement maniacal foxbrusher poster

Glitch: achievement maniacal foxbrusher This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating14.5K Total Reviews
12439 total 5-star reviews1353 total 4-star reviews266 total 3-star reviews155 total 2-star reviews289 total 1-star reviews
14,502 Reviews
Reviews for similar products
5 out of 5 stars rating
By C S.July 26, 2023Verified Purchase
Print, Size: 20.32cm x 25.40cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
My Bible verse postcard, turned out excellent. I love it and have it already framed. It was so reasonably priced for something done so well. Thank you to Zazzle and the artist! I thought it looked exactly like what I ordered. Perfect.
4 out of 5 stars rating
By Lee P.December 25, 2021Verified Purchase
Print, Size: 58.42cm x 87.63cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
Poster is printed clearly, good quality . Inclusive of many prints . The shipping was the problem. Box was flimsy and item got bent.. only suggestion would have been to put in a canister or mark fragile. Printing was exactly as shown
5 out of 5 stars rating
By R.January 28, 2021Verified Purchase
Print, Size: 91.44cm x 60.96cm, Media: Value Poster Paper (Semi-Gloss)
Zazzle Reviewer Program
I am a fan of Ravens and needed to have a poster of my favourite bird. The image quality is sharp.

Tags

Posters
achievementmaniacalfoxbrusherglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementmaniacalfoxbrusherglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 228824825967469703
Designed on 2014-10-23, 8:58 AM
Rating: G