Tap / click on image to see more RealViewsTM
CA$18.70
per keychain
 

Glitch: achievement hardcore carnivore keychain

Qty:
Aluminum Circle
+CA$4.90
+CA$4.90
+CA$23.90
+CA$23.90

Other designs from this category

About Keychains

About This Design

Glitch: achievement hardcore carnivore keychain

Glitch: achievement hardcore carnivore keychain

Glitch: achievement hardcore carnivore This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating5.5K Total Reviews
4294 total 5-star reviews793 total 4-star reviews219 total 3-star reviews119 total 2-star reviews104 total 1-star reviews
5,529 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By J.December 1, 2024Verified Purchase
Metal Circle Keychain, 5.08 cm
Beautifully made, picture has excellent qualiry. I just love it! Thank you!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.February 4, 2026Verified Purchase
Metal Circle Keychain, 5.08 cm
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
from zazzle.com (US)
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jonothon H.April 24, 2023Verified Purchase
Metal Circle Keychain, 5.08 cm
Zazzle Reviewer Program
I was amazed at both price and quality of the picture on this. Also having both sides allowed me to contrast his age from young to mature for his most special send off. Thank you for making me look like the hero when you guys were. Precise, and exactly centered

Tags

Keychains
achievementhardcorecarnivoreglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementhardcorecarnivoreglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 146513769785059743
Designed on 2014-10-22, 12:23 PM
Rating: G