Tap / click on image to see more RealViewsTM
CA$41.75
per apron
 

Glitch: achievement goo getter standard apron

Qty:
Standard
White

Other designs from this category

About Aprons

Sold by

Size: Standard

You won’t have to kiss the cook if you get them one of these classic aprons. It's super useful with its three spacious front pockets - perfect for all your utensils and tools. Select a design from our marketplace or customise it and unleash your creativity!

  • Dimensions: 60.96 cm L x 71.12 cm W
  • Material: 100% Polyester
  • Machine washable

About This Design

Glitch: achievement goo getter standard apron

Glitch: achievement goo getter standard apron

Glitch: achievement goo getter This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating2.4K Total Reviews
1975 total 5-star reviews309 total 4-star reviews42 total 3-star reviews15 total 2-star reviews13 total 1-star reviews
2,354 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By a.January 4, 2022Verified Purchase
Apron, Long
Zazzle Reviewer Program
Very impressed with this item. The material seems to be of good quality (like thin canvas material) and the stitching. I'm confident that this will withstand many uses and washes. The printing turned out excellent. Sharp and detailed. Perfect material to have your message printed. Like how you can customize your message to anything you like.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Rose A.May 21, 2021Verified Purchase
Zazzle Reviewer Program
The quality of this apron is exceptional; I was very pleasantly surprised considering the reasonable cost. The fabric is heavier than I expected and the overall construction is excellent. Colours and patterns were even nicer than depicted on the website when ordering.
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ginette H.November 19, 2018Verified Purchase
Apron, Standard
Zazzle Reviewer Program
Just received my aprons that are gifts doe good friends and I am impressed by the quality of print, the fabric and build of the aprons. The pocket at the bottom of the apron which is 24" lengthwise will be quite useful. Good job! Excellent. Nice colors and print.

Tags

Aprons
achievementgoogetterglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementgoogetterglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 154014932149423791
Designed on 2014-10-21, 6:27 PM
Rating: G