Tap / click on image to see more RealViewsTM
CA$31.15
per tile
 

Glitch: achievement fine refiner blue class tile

Qty:
10.80 cm x 10.80 cm
Frame and Keepsake Boxes available
Starting from CA$6.50
Select your accessory options after adding to cart

Other designs from this category

About Tiles

Sold by

Size: 10.80 cm x 10.80 cm

Display your favorite photos, images, and quotes on this vibrant ceramic tile. You can use your custom tile as a trivet or to upgrade your home deco. This is a fully functioning tile and is great in backsplashes. Great for holiday, wedding, and office gifts.

  • Dimensions: 4.25"l x 4.25"w; Thickness: 0.19"
  • Weight: 3.75 oz.
  • Made of white ceramic
  • Full-color, full-bleed printing
  • Intended for residential use. Suitable for dry or low-moisture indoor wall applications with brief exposure to water (such as backsplashes which are properly sealed and grouted). Not suitable for use on floors. Not suitable for constantly wet areas (like showers). Protect from exposure to direct sunlight. Not frost resistant.
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 4.25" x 4.25". For best results please add 1/8" bleed

About This Design

Glitch: achievement fine refiner blue class tile

Glitch: achievement fine refiner blue class tile

Glitch: achievement fine refiner blue class This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
950 total 5-star reviews63 total 4-star reviews19 total 3-star reviews10 total 2-star reviews11 total 1-star reviews
1,053 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Scott M.August 14, 2024Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
A really beautiful item that I will keep for many years. I highly recommend! Strong beautiful image exactly as I hoped it would be.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Angela M.July 2, 2024Verified Purchase
Ceramic Tile, 15.24 cm x 15.24 cm
Beautiful Tile. Exactly what I was looking for. . Bright and beautiful. Colors are vibrant.
5.0 out of 5 stars rating
5 out of 5 stars rating
By B.January 14, 2020Verified Purchase
Ceramic Tile, 10.80 cm x 10.80 cm
Zazzle Reviewer Program
Was shipped quickly and packaging was superb... Product was simply beautiful, I would highly recommend! I wanted to keep the gift for myself😁. Printing looked great, it was flawless with a glossy finish... beautiful!!

Tags

Tiles
achievementfinerefinerblueclassglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfinerefinerblueclassglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 227212541827224361
Designed on 2014-10-13, 12:37 PM
Rating: G