Tap / click on image to see more RealViewsTM
Sale Price CA$45.78.  
Original Price CA$53.85 per shirt
You save 15%

Glitch: achievement finallyprettygood tree hugger T-Shirt

Qty:
Kids Basic T-Shirt
+CA$41.80
+CA$41.80
Black
Classic Printing: No Underbase
-CA$12.05
-CA$7.20
-CA$12.05
-CA$7.20
-CA$7.20
-CA$7.20
-CA$7.20
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Kids' Basic T-Shirt

Wait 'till you get this tee on your kiddo, it'll take his everyday style to a whole new level--especially when you customize it with your own design.

Size & Fit

  • Model is 135 cm and is wearing a medium
  • Garment is unisex sizing
  • Standard fit
  • True to size

Fabric & Care

  • 6.0 oz.,/203 gsm, pre-shrunk 100% ComfortSoft® cotton; Oxford Green is 60/40
  • Shoulder-to-shoulder taping with coverstitched collar
  • Double-needle stitched armholes and sleeves
  • Imported
  • Machine wash cold

About This Design

Glitch: achievement finallyprettygood tree hugger T-Shirt

Glitch: achievement finallyprettygood tree hugger T-Shirt

Glitch: achievement finallyprettygood tree hugger This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.7 out of 5 stars rating1.9K Total Reviews
1500 total 5-star reviews284 total 4-star reviews78 total 3-star reviews32 total 2-star reviews30 total 1-star reviews
1,924 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Justin C.September 13, 2021Verified Purchase
Kids Basic T-Shirt, White, Youth XS
Zazzle Reviewer Program
Great product and material. Got it as a gift idea. My 6 year old nephew loves marvin the martian. Print and design are fantastic. Trademark product, that's what I was looking for. Colors are bright.
5.0 out of 5 stars rating
5 out of 5 stars rating
By SvetlanaApril 15, 2020Verified Purchase
Kids Basic T-Shirt, White, Youth XS
Zazzle Reviewer Program
I have spend a lot of time looking for a gift to my grandson. This T-shirt is really good quality and fits well. My grandson is very happy. Beautiful picture, excellent printing.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Joyce T.October 17, 2025Verified Purchase
Kids Basic T-Shirt, Black, Youth XS
Super job. Very pleased with this shirt.

Tags

T-Shirts
achievementfinallyprettygoodtreehuggerglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementfinallyprettygoodtreehuggerglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235555322765522712
Designed on 2014-10-13, 11:28 AM
Rating: G