Tap / click on image to see more RealViewsTM
CA$63.10
per bag
 

Glitch: achievement epic urian large tote bag

Qty:
  1. Style

  2. Colour

Other designs from this category

About Bags

Sold by

Style: Jumbo Tote

Design your own tote bag to haul your belongings in style! Available in multiple sizes to fit all your lugging needs, these bags are made of 100% natural material and can be customized with your favorite pictures and text for the perfect gift or casual accessory. Versatile, trendy, and durable, this custom tote means you'll always look fashionable!

  • Dimensions: 36.8cm (L) x 50.8cm (W); 10.2cm deep
  • Material: 100% cotton
  • Squared bottom, perfect for groceries and large items
  • Extra long cotton web handles with stress point reinforced stitching
  • Print on both sides for a small upcharge
  • Recommended care instructions: Hand wash cold. Do not bleach. Lay flat to dry. Do not iron.

About This Design

Glitch: achievement epic urian large tote bag

Glitch: achievement epic urian large tote bag

Glitch: achievement epic urian This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.6 out of 5 stars rating6.9K Total Reviews
5240 total 5-star reviews1125 total 4-star reviews325 total 3-star reviews126 total 2-star reviews95 total 1-star reviews
6,911 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By JoanneJuly 30, 2025Verified Purchase
Budget Tote
As a bag and tote collector because they all have something to say I absolutely am so happy I bought this big tote that says what I am all about is living and learning and teaching. Share the knowledge with others! Thank you so much for this lovely tote!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Brittany S.January 30, 2019Verified Purchase
Jumbo Tote
Zazzle Reviewer Program
This is the tote to go for if you want something sturdy that will last a long time and keep it's shape. Was a gift for a friend who lost a pet and she almost cried. I was worried it might come out a little tacky, but I will probably order this again and would definitely recommend it. The print also went on so well to the canvas-y material. Looks and feels professional and expensive.
5.0 out of 5 stars rating
5 out of 5 stars rating
By RisaJanuary 4, 2020Verified Purchase
Jumbo Tote
Zazzle Reviewer Program
Came out amazing. Was very pleased as was the recipient. It was lovely. Exactly as it had looked in the preview.

Tags

Bags
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementepicurianglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 149160798136599712
Designed on 2014-10-12, 10:30 AM
Rating: G