Tap / click on image to see more RealViewsTM
Sale Price CA$51.73.  
Original Price CA$60.85 per shirt
You save 15%

Glitch: achievement curious george T-Shirt

Qty:
Basic T-Shirt
+CA$19.10
+CA$26.55
Black
Classic Printing: No Underbase
-CA$12.05
-CA$12.05
-CA$12.05
-CA$12.05
Vivid Printing: White Underbase

Other designs from this category

About T-Shirts

Sold by

Style: Women's Basic T-Shirt

This basic t-shirt features a relaxed fit for the female shape. Made from 100% cotton, this t-shirt is both durable and soft – a great combination if you're looking for that casual wardrobe staple. Select a design from our marketplace or customize it and unleash your creativity!

Size & Fit

  • Model is 5'7"/170 cm and is wearing a Small
  • Standard fit
  • Fits true to size

Fabric & Care

  • 100% cotton
  • Tagless label for comfort
  • Double-needle hemmed sleeves and bottom
  • Machine wash cold
  • Imported

About This Design

Glitch: achievement curious george T-Shirt

Glitch: achievement curious george T-Shirt

Glitch: achievement curious george This Glitch product is brought to you by the Vac of Wetdryvac.net, who is most thankful to the folks of GlitchTheGame.com and TinySpeck.com for releasing their entire body of artwork into the public domain. The Vac's plan is to convert and release as much of that artwork on Zazzle as it has the brain space for, to be shared with the Glitch community - a whole lot of seriously awesome folks who helped make the game as lovely as it was - any anyone else who fancies some excellent art printed on various products. Most of these products are converted from the original .fla files to .png with transparency at 4000x4000 pixels. If you’d like to go nab the source material yourself, you can do so here: http://www.glitchthegame.com/ Glitch, Glitchen, the vac misses you all!

Customer Reviews

4.5 out of 5 stars rating15.2K Total Reviews
10781 total 5-star reviews2914 total 4-star reviews847 total 3-star reviews400 total 2-star reviews268 total 1-star reviews
15,210 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By M.February 6, 2023Verified Purchase
Basic T-Shirt, White, Medium
Zazzle Reviewer Program
I like that this turned out exactly as I had hoped. My daughter was missing her father (he passed away recently), and this picture of her with him delighted her! The print job was excellent and the colors were true to the original.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Pam S.October 12, 2025Verified Purchase
Gave it to my daughter as a gift. She loved it. Next time I would order it on white for a crisper image.
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diana W.June 6, 2021Verified Purchase
Basic T-Shirt, White, Small
Zazzle Reviewer Program
It came on time and as described. The fit is perfect and I like the quality as well. I love it and #OrangePillPod Telegram group loves it too :). Print was a bit lighter than expected, but that doesn't bother me at all.

Tags

T-Shirts
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame
All Products
achievementcuriousgeorgeglitchglitchenwetdryvactinyspeckglitchthegame

Other Info

Product ID: 235424801630779165
Designed on 2014-10-07, 12:51 PM
Rating: G